Anti EI24 pAb (ATL-HPA051029)
Atlas Antibodies
- Catalog No.:
- ATL-HPA051029-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: EI24
Alternative Gene Name: EPG4, PIG8, TP53I8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062762: 97%, ENSRNOG00000030391: 97%
Entrez Gene ID: 9538
Uniprot ID: O14681
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | HKTVYLQSALSSSTSAEKFPSPHPSPAKLKA |
Gene Sequence | HKTVYLQSALSSSTSAEKFPSPHPSPAKLKA |
Gene ID - Mouse | ENSMUSG00000062762 |
Gene ID - Rat | ENSRNOG00000030391 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti EI24 pAb (ATL-HPA051029) | |
Datasheet | Anti EI24 pAb (ATL-HPA051029) Datasheet (External Link) |
Vendor Page | Anti EI24 pAb (ATL-HPA051029) at Atlas Antibodies |
Documents & Links for Anti EI24 pAb (ATL-HPA051029) | |
Datasheet | Anti EI24 pAb (ATL-HPA051029) Datasheet (External Link) |
Vendor Page | Anti EI24 pAb (ATL-HPA051029) |