Anti EFR3B pAb (ATL-HPA071831)
Atlas Antibodies
- SKU:
- ATL-HPA071831-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: EFR3B
Alternative Gene Name: FLJ37871, KIAA0953
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020658: 99%, ENSRNOG00000012950: 99%
Entrez Gene ID: 22979
Uniprot ID: Q9Y2G0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DRLLSTALMEDAEIRLFVLEILISFIDRHGNRHKFSTISTLSDISVLKLKVDKCSRQDTVFMKKHSQQL |
Gene Sequence | DRLLSTALMEDAEIRLFVLEILISFIDRHGNRHKFSTISTLSDISVLKLKVDKCSRQDTVFMKKHSQQL |
Gene ID - Mouse | ENSMUSG00000020658 |
Gene ID - Rat | ENSRNOG00000012950 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti EFR3B pAb (ATL-HPA071831) | |
Datasheet | Anti EFR3B pAb (ATL-HPA071831) Datasheet (External Link) |
Vendor Page | Anti EFR3B pAb (ATL-HPA071831) at Atlas Antibodies |
Documents & Links for Anti EFR3B pAb (ATL-HPA071831) | |
Datasheet | Anti EFR3B pAb (ATL-HPA071831) Datasheet (External Link) |
Vendor Page | Anti EFR3B pAb (ATL-HPA071831) |