Anti EFR3B pAb (ATL-HPA071831)

Atlas Antibodies

Catalog No.:
ATL-HPA071831-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: EFR3 homolog B
Gene Name: EFR3B
Alternative Gene Name: FLJ37871, KIAA0953
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020658: 99%, ENSRNOG00000012950: 99%
Entrez Gene ID: 22979
Uniprot ID: Q9Y2G0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DRLLSTALMEDAEIRLFVLEILISFIDRHGNRHKFSTISTLSDISVLKLKVDKCSRQDTVFMKKHSQQL
Gene Sequence DRLLSTALMEDAEIRLFVLEILISFIDRHGNRHKFSTISTLSDISVLKLKVDKCSRQDTVFMKKHSQQL
Gene ID - Mouse ENSMUSG00000020658
Gene ID - Rat ENSRNOG00000012950
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EFR3B pAb (ATL-HPA071831)
Datasheet Anti EFR3B pAb (ATL-HPA071831) Datasheet (External Link)
Vendor Page Anti EFR3B pAb (ATL-HPA071831) at Atlas Antibodies

Documents & Links for Anti EFR3B pAb (ATL-HPA071831)
Datasheet Anti EFR3B pAb (ATL-HPA071831) Datasheet (External Link)
Vendor Page Anti EFR3B pAb (ATL-HPA071831)