Anti EFCAB3 pAb (ATL-HPA046862 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA046862-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: EF-hand calcium binding domain 3
Gene Name: EFCAB3
Alternative Gene Name: FLJ25818
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040838: 77%, ENSRNOG00000042255: 77%
Entrez Gene ID: 146779
Uniprot ID: Q8N7B9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ADATTIKQHVKRATDTYNLGIALEHRKEMLNLWQKIRGDLIGIDSRNE
Gene Sequence ADATTIKQHVKRATDTYNLGIALEHRKEMLNLWQKIRGDLIGIDSRNE
Gene ID - Mouse ENSMUSG00000040838
Gene ID - Rat ENSRNOG00000042255
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EFCAB3 pAb (ATL-HPA046862 w/enhanced validation)
Datasheet Anti EFCAB3 pAb (ATL-HPA046862 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti EFCAB3 pAb (ATL-HPA046862 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti EFCAB3 pAb (ATL-HPA046862 w/enhanced validation)
Datasheet Anti EFCAB3 pAb (ATL-HPA046862 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti EFCAB3 pAb (ATL-HPA046862 w/enhanced validation)