Anti EEF1D pAb (ATL-HPA051002)

Atlas Antibodies

Catalog No.:
ATL-HPA051002-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: eukaryotic translation elongation factor 1 delta (guanine nucleotide exchange protein)
Gene Name: EEF1D
Alternative Gene Name: EF-1D, FLJ20897
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055762: 80%, ENSRNOG00000021638: 81%
Entrez Gene ID: 1936
Uniprot ID: P29692
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PRKSQDSRKPLQKKRKRSPKSGLGPADLALLGLSAERVWLDKSLFDQAESSYRQKLADVAAQAAWPPALAPWGLCTHGNQVACHHVTWGIWVNKSS
Gene Sequence PRKSQDSRKPLQKKRKRSPKSGLGPADLALLGLSAERVWLDKSLFDQAESSYRQKLADVAAQAAWPPALAPWGLCTHGNQVACHHVTWGIWVNKSS
Gene ID - Mouse ENSMUSG00000055762
Gene ID - Rat ENSRNOG00000021638
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EEF1D pAb (ATL-HPA051002)
Datasheet Anti EEF1D pAb (ATL-HPA051002) Datasheet (External Link)
Vendor Page Anti EEF1D pAb (ATL-HPA051002) at Atlas Antibodies

Documents & Links for Anti EEF1D pAb (ATL-HPA051002)
Datasheet Anti EEF1D pAb (ATL-HPA051002) Datasheet (External Link)
Vendor Page Anti EEF1D pAb (ATL-HPA051002)