Anti EDARADD pAb (ATL-HPA018836 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA018836-25

• 
• 

Protein Description: EDAR-associated death domain
Gene Name: EDARADD
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000095105: 91%, ENSRNOG00000002624: 91%
Entrez Gene ID: 128178
Uniprot ID: Q8WWZ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PTISDLLNDQDLLDVIRIKLDPCHPTVKNWRNFASKWGMSYDELCFLEQRPQSPTLEFLLRNSQRTVGQLMELCRLYHRADVEKVLRRWVDEEWPKRERGDP
• Gene Sequence: PTISDLLNDQDLLDVIRIKLDPCHPTVKNWRNFASKWGMSYDELCFLEQRPQSPTLEFLLRNSQRTVGQLMELCRLYHRADVEKVLRRWVDEEWPKRERGDP
• Gene ID - Mouse: ENSMUSG00000095105
• Gene ID - Rat: ENSRNOG00000002624
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti EDARADD pAb (ATL-HPA018836 w/enhanced validation) – 1 Found

Lawrence, Mitchell G; Pidsley, Ruth; Niranjan, Birunthi; Papargiris, Melissa; Pereira, Brooke A; Richards, Michelle; Teng, Linda; Norden, Sam; Ryan, Andrew; Frydenberg, Mark; Stirzaker, Clare; Taylor, Renea A; Risbridger, Gail P; Clark, Susan J. Alterations in the methylome of the stromal tumour microenvironment signal the presence and severity of prostate cancer. Clinical Epigenetics. 2020;12(1):48.