Anti DYNC1I2 pAb (ATL-HPA040619 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA040619-25

• 
• 
• 

Protein Description: dynein, cytoplasmic 1, intermediate chain 2
Gene Name: DYNC1I2
Alternative Gene Name: DNCI2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027012: 98%, ENSRNOG00000009781: 98%
Entrez Gene ID: 1781
Uniprot ID: Q13409
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HSDSDLGRGPIKLGMAKITQVDFPPREIVTYTKETQTPVMAQPKEDEEE
• Gene Sequence: HSDSDLGRGPIKLGMAKITQVDFPPREIVTYTKETQTPVMAQPKEDEEE
• Gene ID - Mouse: ENSMUSG00000027012
• Gene ID - Rat: ENSRNOG00000009781
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.