Anti DUSP28 pAb (ATL-HPA047456)

Atlas Antibodies

Catalog No.:
ATL-HPA047456-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: dual specificity phosphatase 28
Gene Name: DUSP28
Alternative Gene Name: DUSP26, VHP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047067: 74%, ENSRNOG00000057389: 74%
Entrez Gene ID: 285193
Uniprot ID: Q4G0W2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence GACLVYCKNGRSRSAAVCTAYLMRHRGLSLAKAFQMVKSARPVAEPNPGFWSQLQKYEEALQAQSCLQGEPPALGLGPEA
Gene ID - Mouse ENSMUSG00000047067
Gene ID - Rat ENSMUSG00000047067
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DUSP28 pAb (ATL-HPA047456)
Datasheet Anti DUSP28 pAb (ATL-HPA047456) Datasheet (External Link)
Vendor Page Anti DUSP28 pAb (ATL-HPA047456) at Atlas Antibodies

Documents & Links for Anti DUSP28 pAb (ATL-HPA047456)
Datasheet Anti DUSP28 pAb (ATL-HPA047456) Datasheet (External Link)
Vendor Page Anti DUSP28 pAb (ATL-HPA047456)