Anti DUS3L pAb (ATL-HPA041944)

Atlas Antibodies

SKU:
ATL-HPA041944-25
  • Immunohistochemical staining of human rectum shows strong cytoplasmic positivity in glandular cells.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: dihydrouridine synthase 3-like (S. cerevisiae)
Gene Name: DUS3L
Alternative Gene Name: DUS3, FLJ13896
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007603: 95%, ENSRNOG00000050381: 95%
Entrez Gene ID: 56931
Uniprot ID: Q96G46
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MPLFGNGDILSFEDANRAMQTGVTGIMIARGALLKPWLFTEIKEQRHWDISSSERLDILRDFTNYGLEHWGSDTQGVEKTRRFLLEWLSFLCRYV
Gene Sequence MPLFGNGDILSFEDANRAMQTGVTGIMIARGALLKPWLFTEIKEQRHWDISSSERLDILRDFTNYGLEHWGSDTQGVEKTRRFLLEWLSFLCRYV
Gene ID - Mouse ENSMUSG00000007603
Gene ID - Rat ENSRNOG00000050381
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DUS3L pAb (ATL-HPA041944)
Datasheet Anti DUS3L pAb (ATL-HPA041944) Datasheet (External Link)
Vendor Page Anti DUS3L pAb (ATL-HPA041944) at Atlas Antibodies

Documents & Links for Anti DUS3L pAb (ATL-HPA041944)
Datasheet Anti DUS3L pAb (ATL-HPA041944) Datasheet (External Link)
Vendor Page Anti DUS3L pAb (ATL-HPA041944)



Citations for Anti DUS3L pAb (ATL-HPA041944) – 1 Found
Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.  PubMed