Anti DSC1 pAb (ATL-HPA012891)
Atlas Antibodies
- SKU:
- ATL-HPA012891-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: DSC1
Alternative Gene Name: CDHF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044322: 73%, ENSRNOG00000056258: 70%
Entrez Gene ID: 1823
Uniprot ID: Q08554
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SCTGTLVVHLDDYNDHAPQIDKEVTICQNNEDFAVLKPVDPDGPENGPPFQFFLDNSASKNWNIEEKDGKTAILRQRQNLDYNYYSVPIQIKDRHGLVATHMLTVRVCDCSTPSECRMKDKSTR |
| Gene Sequence | SCTGTLVVHLDDYNDHAPQIDKEVTICQNNEDFAVLKPVDPDGPENGPPFQFFLDNSASKNWNIEEKDGKTAILRQRQNLDYNYYSVPIQIKDRHGLVATHMLTVRVCDCSTPSECRMKDKSTR |
| Gene ID - Mouse | ENSMUSG00000044322 |
| Gene ID - Rat | ENSRNOG00000056258 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DSC1 pAb (ATL-HPA012891) | |
| Datasheet | Anti DSC1 pAb (ATL-HPA012891) Datasheet (External Link) |
| Vendor Page | Anti DSC1 pAb (ATL-HPA012891) at Atlas Antibodies |
| Documents & Links for Anti DSC1 pAb (ATL-HPA012891) | |
| Datasheet | Anti DSC1 pAb (ATL-HPA012891) Datasheet (External Link) |
| Vendor Page | Anti DSC1 pAb (ATL-HPA012891) |
| Citations for Anti DSC1 pAb (ATL-HPA012891) – 1 Found |
| Paavilainen, Linda; Edvinsson, Asa; Asplund, Anna; Hober, Sophia; Kampf, Caroline; Pontén, Fredrik; Wester, Kenneth. The impact of tissue fixatives on morphology and antibody-based protein profiling in tissues and cells. The Journal Of Histochemistry And Cytochemistry : Official Journal Of The Histochemistry Society. 2010;58(3):237-46. PubMed |