Anti DSC1 pAb (ATL-HPA012891)

Atlas Antibodies

Catalog No.: ATL-HPA012891-25

Protein Description: desmocollin 1
Gene Name: DSC1
Alternative Gene Name: CDHF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044322: 73%, ENSRNOG00000056258: 70%
Entrez Gene ID: 1823
Uniprot ID: Q08554
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SCTGTLVVHLDDYNDHAPQIDKEVTICQNNEDFAVLKPVDPDGPENGPPFQFFLDNSASKNWNIEEKDGKTAILRQRQNLDYNYYSVPIQIKDRHGLVATHMLTVRVCDCSTPSECRMKDKSTR
• Gene Sequence: SCTGTLVVHLDDYNDHAPQIDKEVTICQNNEDFAVLKPVDPDGPENGPPFQFFLDNSASKNWNIEEKDGKTAILRQRQNLDYNYYSVPIQIKDRHGLVATHMLTVRVCDCSTPSECRMKDKSTR
• Gene ID - Mouse: ENSMUSG00000044322
• Gene ID - Rat: ENSRNOG00000056258
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti DSC1 pAb (ATL-HPA012891) – 1 Found

Paavilainen, Linda; Edvinsson, Asa; Asplund, Anna; Hober, Sophia; Kampf, Caroline; Pontén, Fredrik; Wester, Kenneth. The impact of tissue fixatives on morphology and antibody-based protein profiling in tissues and cells. The Journal Of Histochemistry And Cytochemistry : Official Journal Of The Histochemistry Society. 2010;58(3):237-46.