Anti DPM1 pAb (ATL-HPA051818)
Atlas Antibodies
- Catalog No.:
- ATL-HPA051818-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: DPM1
Alternative Gene Name: CDGIE, MPDS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000093752: 78%, ENSRNOG00000010993: 81%
Entrez Gene ID: 8813
Uniprot ID: O60762
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SLEVSRSPRRSRRELEVRSPRQNKYSVLLPTYNERENLPLIVWLLVKSFSESGINYEIIIIDDGSPDGTRDVAEQLEKIYGSD |
| Gene Sequence | SLEVSRSPRRSRRELEVRSPRQNKYSVLLPTYNERENLPLIVWLLVKSFSESGINYEIIIIDDGSPDGTRDVAEQLEKIYGSD |
| Gene ID - Mouse | ENSMUSG00000093752 |
| Gene ID - Rat | ENSRNOG00000010993 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DPM1 pAb (ATL-HPA051818) | |
| Datasheet | Anti DPM1 pAb (ATL-HPA051818) Datasheet (External Link) |
| Vendor Page | Anti DPM1 pAb (ATL-HPA051818) at Atlas Antibodies |
| Documents & Links for Anti DPM1 pAb (ATL-HPA051818) | |
| Datasheet | Anti DPM1 pAb (ATL-HPA051818) Datasheet (External Link) |
| Vendor Page | Anti DPM1 pAb (ATL-HPA051818) |