Anti DPM1 pAb (ATL-HPA051818)

Atlas Antibodies

SKU: ATL-HPA051818-25

• 

Protein Description: dolichyl-phosphate mannosyltransferase polypeptide 1, catalytic subunit
Gene Name: DPM1
Alternative Gene Name: CDGIE, MPDS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000093752: 78%, ENSRNOG00000010993: 81%
Entrez Gene ID: 8813
Uniprot ID: O60762
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SLEVSRSPRRSRRELEVRSPRQNKYSVLLPTYNERENLPLIVWLLVKSFSESGINYEIIIIDDGSPDGTRDVAEQLEKIYGSD
• Gene Sequence: SLEVSRSPRRSRRELEVRSPRQNKYSVLLPTYNERENLPLIVWLLVKSFSESGINYEIIIIDDGSPDGTRDVAEQLEKIYGSD
• Gene ID - Mouse: ENSMUSG00000093752
• Gene ID - Rat: ENSRNOG00000010993
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.