Anti DPM1 pAb (ATL-HPA051818)
Atlas Antibodies
- Catalog No.:
- ATL-HPA051818-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: DPM1
Alternative Gene Name: CDGIE, MPDS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000093752: 78%, ENSRNOG00000010993: 81%
Entrez Gene ID: 8813
Uniprot ID: O60762
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SLEVSRSPRRSRRELEVRSPRQNKYSVLLPTYNERENLPLIVWLLVKSFSESGINYEIIIIDDGSPDGTRDVAEQLEKIYGSD |
Gene Sequence | SLEVSRSPRRSRRELEVRSPRQNKYSVLLPTYNERENLPLIVWLLVKSFSESGINYEIIIIDDGSPDGTRDVAEQLEKIYGSD |
Gene ID - Mouse | ENSMUSG00000093752 |
Gene ID - Rat | ENSRNOG00000010993 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti DPM1 pAb (ATL-HPA051818) | |
Datasheet | Anti DPM1 pAb (ATL-HPA051818) Datasheet (External Link) |
Vendor Page | Anti DPM1 pAb (ATL-HPA051818) at Atlas Antibodies |
Documents & Links for Anti DPM1 pAb (ATL-HPA051818) | |
Datasheet | Anti DPM1 pAb (ATL-HPA051818) Datasheet (External Link) |
Vendor Page | Anti DPM1 pAb (ATL-HPA051818) |