Anti DOCK9 pAb (ATL-HPA043940)

Atlas Antibodies

SKU: ATL-HPA043940-25

• 
• 

Protein Description: dedicator of cytokinesis 9
Gene Name: DOCK9
Alternative Gene Name: KIAA1058, ZIZ1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025558: 96%, ENSRNOG00000011969: 96%
Entrez Gene ID: 23348
Uniprot ID: Q9BZ29
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LQLNFEAAMQEKRNGDSHEDDEQSKLEGSGSGLDSYLPELAKSAREAEIKLKSESRVKLFYLDPDAQKLDFSSAEPEV
• Gene Sequence: LQLNFEAAMQEKRNGDSHEDDEQSKLEGSGSGLDSYLPELAKSAREAEIKLKSESRVKLFYLDPDAQKLDFSSAEPEV
• Gene ID - Mouse: ENSMUSG00000025558
• Gene ID - Rat: ENSRNOG00000011969
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.