Anti DNAJC27 pAb (ATL-HPA036816)

Atlas Antibodies

SKU:
ATL-HPA036816-25
  • Immunohistochemical staining of human testis shows cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and DNAJC27 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY413917).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: DnaJ (Hsp40) homolog, subfamily C, member 27
Gene Name: DNAJC27
Alternative Gene Name: RabJS, RBJ
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020657: 93%, ENSRNOG00000003988: 91%
Entrez Gene ID: 51277
Uniprot ID: Q9NZQ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GGKRPTTNSSASFTKEQADAIRRIRNSKDSWDMLGVKPGASRDEVNKAYRKLAVLLHPDKCVAPGSEDAFKAVVNARTALLK
Gene Sequence GGKRPTTNSSASFTKEQADAIRRIRNSKDSWDMLGVKPGASRDEVNKAYRKLAVLLHPDKCVAPGSEDAFKAVVNARTALLK
Gene ID - Mouse ENSMUSG00000020657
Gene ID - Rat ENSRNOG00000003988
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DNAJC27 pAb (ATL-HPA036816)
Datasheet Anti DNAJC27 pAb (ATL-HPA036816) Datasheet (External Link)
Vendor Page Anti DNAJC27 pAb (ATL-HPA036816) at Atlas Antibodies

Documents & Links for Anti DNAJC27 pAb (ATL-HPA036816)
Datasheet Anti DNAJC27 pAb (ATL-HPA036816) Datasheet (External Link)
Vendor Page Anti DNAJC27 pAb (ATL-HPA036816)