Anti DNAH2 pAb (ATL-HPA067103 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA067103-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: DNAH2
Alternative Gene Name: DNHD3, FLJ46675, KIAA1503
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005237: 96%, ENSRNOG00000052688: 95%
Entrez Gene ID: 146754
Uniprot ID: Q9P225
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PGEWENACNEMQRMLIVRSLRQDRVAFCVTSFIITNLGSRFIEPPVLNMKSVLEDSTPRSPLVFILSPGVDPTSALL |
Gene Sequence | PGEWENACNEMQRMLIVRSLRQDRVAFCVTSFIITNLGSRFIEPPVLNMKSVLEDSTPRSPLVFILSPGVDPTSALL |
Gene ID - Mouse | ENSMUSG00000005237 |
Gene ID - Rat | ENSRNOG00000052688 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti DNAH2 pAb (ATL-HPA067103 w/enhanced validation) | |
Datasheet | Anti DNAH2 pAb (ATL-HPA067103 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti DNAH2 pAb (ATL-HPA067103 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti DNAH2 pAb (ATL-HPA067103 w/enhanced validation) | |
Datasheet | Anti DNAH2 pAb (ATL-HPA067103 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti DNAH2 pAb (ATL-HPA067103 w/enhanced validation) |
Citations for Anti DNAH2 pAb (ATL-HPA067103 w/enhanced validation) – 4 Found |
Tu, Chaofeng; Cong, Jiangshan; Zhang, Qianjun; He, Xiaojin; Zheng, Rui; Yang, Xiaoxuan; Gao, Yang; Wu, Huan; Lv, Mingrong; Gu, Yayun; Lu, Shuai; Liu, Chunyu; Tian, Shixiong; Meng, Lanlan; Wang, Weili; Tan, Chen; Nie, Hongchuan; Li, Dongyan; Zhang, Huan; Gong, Fei; Hu, Liang; Lu, Guangxiu; Xu, Wenming; Lin, Ge; Zhang, Feng; Cao, Yunxia; Tan, Yue-Qiu. Bi-allelic mutations of DNAH10 cause primary male infertility with asthenoteratozoospermia in humans and mice. American Journal Of Human Genetics. 2021;108(8):1466-1477. PubMed |
Lu, Shuai; Gu, Yayun; Wu, Yifei; Yang, Shenmin; Li, Chenmeijie; Meng, Lanlan; Yuan, Wenwen; Jiang, Tao; Zhang, Xin; Li, Yang; Wang, Cheng; Liu, Mingxi; Ye, Lan; Guo, Xuejiang; Shen, Hongbing; Yang, Xiaoyu; Tan, Yueqiu; Hu, Zhibin. Bi-allelic variants in human WDR63 cause male infertility via abnormal inner dynein arms assembly. Cell Discovery. 2021;7(1):110. PubMed |
Whitfield, Marjorie; Thomas, Lucie; Bequignon, Emilie; Schmitt, Alain; Stouvenel, Laurence; Montantin, Guy; Tissier, Sylvie; Duquesnoy, Philippe; Copin, Bruno; Chantot, Sandra; Dastot, Florence; Faucon, Catherine; Barbotin, Anne Laure; Loyens, Anne; Siffroi, Jean-Pierre; Papon, Jean-François; Escudier, Estelle; Amselem, Serge; Mitchell, Valérie; Touré, Aminata; Legendre, Marie. Mutations in DNAH17, Encoding a Sperm-Specific Axonemal Outer Dynein Arm Heavy Chain, Cause Isolated Male Infertility Due to Asthenozoospermia. American Journal Of Human Genetics. 2019;105(1):198-212. PubMed |
Xu, Yingjie; Yang, Binyi; Lei, Cheng; Yang, Danhui; Ding, Shuizi; Lu, Chenyang; Wang, Lin; Guo, Ting; Wang, Rongchun; Luo, Hong. Novel Compound Heterozygous Variants in CCDC40 Associated with Primary Ciliary Dyskinesia and Multiple Morphological Abnormalities of the Sperm Flagella. Pharmacogenomics And Personalized Medicine. 15( 35449766):341-350. PubMed |