Anti DNAH17 pAb (ATL-HPA024354)
Atlas Antibodies
- Catalog No.:
- ATL-HPA024354-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: DNAH17
Alternative Gene Name: DNAHL1, DNEL2, FLJ40457
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033987: 76%, ENSRNOG00000003028: 79%
Entrez Gene ID: 8632
Uniprot ID: Q9UFH2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VFQYIQEVREILHNLQNRMQKAKQNIEGISQAMKDWSANPLFERKDNKKEALLDLDGRIANLNKRYAAVRDAGVKIQAMVAVRKHPG |
| Gene Sequence | VFQYIQEVREILHNLQNRMQKAKQNIEGISQAMKDWSANPLFERKDNKKEALLDLDGRIANLNKRYAAVRDAGVKIQAMVAVRKHPG |
| Gene ID - Mouse | ENSMUSG00000033987 |
| Gene ID - Rat | ENSRNOG00000003028 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DNAH17 pAb (ATL-HPA024354) | |
| Datasheet | Anti DNAH17 pAb (ATL-HPA024354) Datasheet (External Link) |
| Vendor Page | Anti DNAH17 pAb (ATL-HPA024354) at Atlas Antibodies |
| Documents & Links for Anti DNAH17 pAb (ATL-HPA024354) | |
| Datasheet | Anti DNAH17 pAb (ATL-HPA024354) Datasheet (External Link) |
| Vendor Page | Anti DNAH17 pAb (ATL-HPA024354) |
| Citations for Anti DNAH17 pAb (ATL-HPA024354) – 3 Found |
| Tu, Chaofeng; Cong, Jiangshan; Zhang, Qianjun; He, Xiaojin; Zheng, Rui; Yang, Xiaoxuan; Gao, Yang; Wu, Huan; Lv, Mingrong; Gu, Yayun; Lu, Shuai; Liu, Chunyu; Tian, Shixiong; Meng, Lanlan; Wang, Weili; Tan, Chen; Nie, Hongchuan; Li, Dongyan; Zhang, Huan; Gong, Fei; Hu, Liang; Lu, Guangxiu; Xu, Wenming; Lin, Ge; Zhang, Feng; Cao, Yunxia; Tan, Yue-Qiu. Bi-allelic mutations of DNAH10 cause primary male infertility with asthenoteratozoospermia in humans and mice. American Journal Of Human Genetics. 2021;108(8):1466-1477. PubMed |
| Whitfield, Marjorie; Thomas, Lucie; Bequignon, Emilie; Schmitt, Alain; Stouvenel, Laurence; Montantin, Guy; Tissier, Sylvie; Duquesnoy, Philippe; Copin, Bruno; Chantot, Sandra; Dastot, Florence; Faucon, Catherine; Barbotin, Anne Laure; Loyens, Anne; Siffroi, Jean-Pierre; Papon, Jean-François; Escudier, Estelle; Amselem, Serge; Mitchell, Valérie; Touré, Aminata; Legendre, Marie. Mutations in DNAH17, Encoding a Sperm-Specific Axonemal Outer Dynein Arm Heavy Chain, Cause Isolated Male Infertility Due to Asthenozoospermia. American Journal Of Human Genetics. 2019;105(1):198-212. PubMed |
| Aprea, Isabella; Raidt, Johanna; Höben, Inga Marlena; Loges, Niki Tomas; Nöthe-Menchen, Tabea; Pennekamp, Petra; Olbrich, Heike; Kaiser, Thomas; Biebach, Luisa; Tüttelmann, Frank; Horvath, Judit; Schubert, Maria; Krallmann, Claudia; Kliesch, Sabine; Omran, Heymut. Defects in the cytoplasmic assembly of axonemal dynein arms cause morphological abnormalities and dysmotility in sperm cells leading to male infertility. Plos Genetics. 2021;17(2):e1009306. PubMed |