Anti DEFB107A pAb (ATL-HPA045626)
Atlas Antibodies
- Catalog No.:
- ATL-HPA045626-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: DEFB107A
Alternative Gene Name: DEFB-7, DEFB107
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044222: 44%, ENSRNOG00000038157: 49%
Entrez Gene ID: 245910
Uniprot ID: Q8IZN7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QARTAIHRALISKRMEGHCEAECLTFEVKIGGCRAELAP |
| Gene Sequence | QARTAIHRALISKRMEGHCEAECLTFEVKIGGCRAELAP |
| Gene ID - Mouse | ENSMUSG00000044222 |
| Gene ID - Rat | ENSRNOG00000038157 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DEFB107A pAb (ATL-HPA045626) | |
| Datasheet | Anti DEFB107A pAb (ATL-HPA045626) Datasheet (External Link) |
| Vendor Page | Anti DEFB107A pAb (ATL-HPA045626) at Atlas Antibodies |
| Documents & Links for Anti DEFB107A pAb (ATL-HPA045626) | |
| Datasheet | Anti DEFB107A pAb (ATL-HPA045626) Datasheet (External Link) |
| Vendor Page | Anti DEFB107A pAb (ATL-HPA045626) |