Anti DEFB107A pAb (ATL-HPA045626)
Atlas Antibodies
- Catalog No.:
- ATL-HPA045626-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: DEFB107A
Alternative Gene Name: DEFB-7, DEFB107
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044222: 44%, ENSRNOG00000038157: 49%
Entrez Gene ID: 245910
Uniprot ID: Q8IZN7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QARTAIHRALISKRMEGHCEAECLTFEVKIGGCRAELAP |
Gene Sequence | QARTAIHRALISKRMEGHCEAECLTFEVKIGGCRAELAP |
Gene ID - Mouse | ENSMUSG00000044222 |
Gene ID - Rat | ENSRNOG00000038157 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti DEFB107A pAb (ATL-HPA045626) | |
Datasheet | Anti DEFB107A pAb (ATL-HPA045626) Datasheet (External Link) |
Vendor Page | Anti DEFB107A pAb (ATL-HPA045626) at Atlas Antibodies |
Documents & Links for Anti DEFB107A pAb (ATL-HPA045626) | |
Datasheet | Anti DEFB107A pAb (ATL-HPA045626) Datasheet (External Link) |
Vendor Page | Anti DEFB107A pAb (ATL-HPA045626) |