Anti DEF6 pAb (ATL-HPA038976 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA038976-25

• 
• 

Protein Description: differentially expressed in FDCP 6 homolog (mouse)
Gene Name: DEF6
Alternative Gene Name: IBP, SLAT, SWAP70L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002257: 91%, ENSRNOG00000000502: 90%
Entrez Gene ID: 50619
Uniprot ID: Q9H4E7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RADEDVEAAQRKLRQASTNVKHWNVQMNRLMHPIEPGDKRPVTSSSFSGFQPPLLAHRDSSLKRLTRWGSQGNRTPSPNSNEQQKSLNGG
• Gene Sequence: RADEDVEAAQRKLRQASTNVKHWNVQMNRLMHPIEPGDKRPVTSSSFSGFQPPLLAHRDSSLKRLTRWGSQGNRTPSPNSNEQQKSLNGG
• Gene ID - Mouse: ENSMUSG00000002257
• Gene ID - Rat: ENSRNOG00000000502
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.