Anti DDI2 pAb (ATL-HPA043119)

Atlas Antibodies

Catalog No.:
ATL-HPA043119-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: DNA-damage inducible 1 homolog 2 (S. cerevisiae)
Gene Name: DDI2
Alternative Gene Name: MGC14844
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078515: 93%, ENSRNOG00000012274: 84%
Entrez Gene ID: 84301
Uniprot ID: Q5TDH0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EGELPECARLAYGAGREDVRPEEIADQELAEALQKSAEDAERQKP
Gene Sequence EGELPECARLAYGAGREDVRPEEIADQELAEALQKSAEDAERQKP
Gene ID - Mouse ENSMUSG00000078515
Gene ID - Rat ENSRNOG00000012274
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DDI2 pAb (ATL-HPA043119)
Datasheet Anti DDI2 pAb (ATL-HPA043119) Datasheet (External Link)
Vendor Page Anti DDI2 pAb (ATL-HPA043119) at Atlas Antibodies

Documents & Links for Anti DDI2 pAb (ATL-HPA043119)
Datasheet Anti DDI2 pAb (ATL-HPA043119) Datasheet (External Link)
Vendor Page Anti DDI2 pAb (ATL-HPA043119)