Anti DCX pAb (ATL-HPA036121)
Atlas Antibodies
- SKU:
- ATL-HPA036121-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: DCX
Alternative Gene Name: DBCN, DC, LISX, SCLH, XLIS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031285: 99%, ENSRNOG00000047712: 94%
Entrez Gene ID: 1641
Uniprot ID: O43602
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KFRYAQDDFSLDENECRVMKGNPSATAGPKASPTPQKTSAKSPGPMRRSKSPADSANGTSSSQLSTPKSKQSPISTPTS |
Gene Sequence | KFRYAQDDFSLDENECRVMKGNPSATAGPKASPTPQKTSAKSPGPMRRSKSPADSANGTSSSQLSTPKSKQSPISTPTS |
Gene ID - Mouse | ENSMUSG00000031285 |
Gene ID - Rat | ENSRNOG00000047712 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti DCX pAb (ATL-HPA036121) | |
Datasheet | Anti DCX pAb (ATL-HPA036121) Datasheet (External Link) |
Vendor Page | Anti DCX pAb (ATL-HPA036121) at Atlas Antibodies |
Documents & Links for Anti DCX pAb (ATL-HPA036121) | |
Datasheet | Anti DCX pAb (ATL-HPA036121) Datasheet (External Link) |
Vendor Page | Anti DCX pAb (ATL-HPA036121) |