Anti DCUN1D5 pAb (ATL-HPA050863)

Atlas Antibodies

Catalog No.:
ATL-HPA050863-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: DCN1, defective in cullin neddylation 1, domain containing 5
Gene Name: DCUN1D5
Alternative Gene Name: FLJ32431, MGC2714
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032002: 91%, ENSRNOG00000008390: 93%
Entrez Gene ID: 84259
Uniprot ID: Q9BTE7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MPVKKKRKSPGVAAAVAEDGGLKKCKISSYCRSQPPARLISGEEHFSSKKCLAWF
Gene Sequence MPVKKKRKSPGVAAAVAEDGGLKKCKISSYCRSQPPARLISGEEHFSSKKCLAWF
Gene ID - Mouse ENSMUSG00000032002
Gene ID - Rat ENSRNOG00000008390
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DCUN1D5 pAb (ATL-HPA050863)
Datasheet Anti DCUN1D5 pAb (ATL-HPA050863) Datasheet (External Link)
Vendor Page Anti DCUN1D5 pAb (ATL-HPA050863) at Atlas Antibodies

Documents & Links for Anti DCUN1D5 pAb (ATL-HPA050863)
Datasheet Anti DCUN1D5 pAb (ATL-HPA050863) Datasheet (External Link)
Vendor Page Anti DCUN1D5 pAb (ATL-HPA050863)