Anti DCHS2 pAb (ATL-HPA064159)

Atlas Antibodies

Catalog No.:
ATL-HPA064159-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: dachsous cadherin-related 2
Gene Name: DCHS2
Alternative Gene Name: CDH27, CDHJ, CDHR7, FLJ20047, PCDH23, PCDHJ
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000102692: 69%, ENSRNOG00000031643: 44%
Entrez Gene ID: 54798
Uniprot ID: Q6V1P9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VEASDGGNPDLRALTLVEIGIEDMNNYAPEFTVKSYNLSLSEDALVGSTLVTFSNIDHDWTRENTYVEYSIISGNSQN
Gene Sequence VEASDGGNPDLRALTLVEIGIEDMNNYAPEFTVKSYNLSLSEDALVGSTLVTFSNIDHDWTRENTYVEYSIISGNSQN
Gene ID - Mouse ENSMUSG00000102692
Gene ID - Rat ENSRNOG00000031643
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DCHS2 pAb (ATL-HPA064159)
Datasheet Anti DCHS2 pAb (ATL-HPA064159) Datasheet (External Link)
Vendor Page Anti DCHS2 pAb (ATL-HPA064159) at Atlas Antibodies

Documents & Links for Anti DCHS2 pAb (ATL-HPA064159)
Datasheet Anti DCHS2 pAb (ATL-HPA064159) Datasheet (External Link)
Vendor Page Anti DCHS2 pAb (ATL-HPA064159)
Citations for Anti DCHS2 pAb (ATL-HPA064159) – 2 Found
Verstockt, Bram; Verstockt, Sare; Veny, Marisol; Dehairs, Jonas; Arnauts, Kaline; Van Assche, Gert; De Hertogh, Gert; Vermeire, Séverine; Salas, Azucena; Ferrante, Marc. Expression Levels of 4 Genes in Colon Tissue Might Be Used to Predict Which Patients Will Enter Endoscopic Remission After Vedolizumab Therapy for Inflammatory Bowel Diseases. Clinical Gastroenterology And Hepatology : The Official Clinical Practice Journal Of The American Gastroenterological Association. 2020;18(5):1142-1151.e10.  PubMed
Lodge, Emily J; Xekouki, Paraskevi; Silva, Tatiane S; Kochi, Cristiane; Longui, Carlos A; Faucz, Fabio R; Santambrogio, Alice; Mills, James L; Pankratz, Nathan; Lane, John; Sosnowska, Dominika; Hodgson, Tina; Patist, Amanda L; Francis-West, Philippa; Helmbacher, Francoise; Stratakis, Constantine; Andoniadou, Cynthia L. Requirement of FAT and DCHS protocadherins during hypothalamic-pituitary development. Jci Insight. 2020;5(23)  PubMed