Anti DCDC2 pAb (ATL-HPA031582)

Atlas Antibodies

Catalog No.:
ATL-HPA031582-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: doublecortin domain containing 2
Gene Name: DCDC2
Alternative Gene Name: DCDC2A, KIAA1154, RU2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035910: 80%, ENSRNOG00000017511: 81%
Entrez Gene ID: 51473
Uniprot ID: Q9UHG0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LTKLKQNVKLKNSQETIPNSDEGIFKAGAERSETRGAAEVQEDEDTQVEVPVDQRPAEIVDEEEDGEKANKDAEQKEDFSGMNGDL
Gene Sequence LTKLKQNVKLKNSQETIPNSDEGIFKAGAERSETRGAAEVQEDEDTQVEVPVDQRPAEIVDEEEDGEKANKDAEQKEDFSGMNGDL
Gene ID - Mouse ENSMUSG00000035910
Gene ID - Rat ENSRNOG00000017511
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DCDC2 pAb (ATL-HPA031582)
Datasheet Anti DCDC2 pAb (ATL-HPA031582) Datasheet (External Link)
Vendor Page Anti DCDC2 pAb (ATL-HPA031582) at Atlas Antibodies

Documents & Links for Anti DCDC2 pAb (ATL-HPA031582)
Datasheet Anti DCDC2 pAb (ATL-HPA031582) Datasheet (External Link)
Vendor Page Anti DCDC2 pAb (ATL-HPA031582)
Citations for Anti DCDC2 pAb (ATL-HPA031582) – 1 Found
Jeruschke, Stefanie; Jeruschke, Kay; DiStasio, Andrew; Karaterzi, Sinem; Büscher, Anja K; Nalbant, Perihan; Klein-Hitpass, Ludger; Hoyer, Peter F; Weiss, Jürgen; Stottmann, Rolf W; Weber, Stefanie. Everolimus Stabilizes Podocyte Microtubules via Enhancing TUBB2B and DCDC2 Expression. Plos One. 10(9):e0137043.  PubMed