Anti DBT pAb (ATL-HPA026485 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA026485-25

• 
• 
• 

Protein Description: dihydrolipoamide branched chain transacylase E2
Gene Name: DBT
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000340: 95%, ENSRNOG00000015029: 95%
Entrez Gene ID: 1629
Uniprot ID: P11182
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VGKPLVDIETEALKDSEEDVVETPAVSHDEHTHQEIKGRKTLATPAVRRLAMENNIKLSEVVGSGKDGRILKEDILNYLEKQ
• Gene Sequence: VGKPLVDIETEALKDSEEDVVETPAVSHDEHTHQEIKGRKTLATPAVRRLAMENNIKLSEVVGSGKDGRILKEDILNYLEKQ
• Gene ID - Mouse: ENSMUSG00000000340
• Gene ID - Rat: ENSRNOG00000015029
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.