Anti DBH pAb (ATL-HPA070789 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA070789-100
  • Immunohistochemistry analysis in human adrenal gland and testis tissues using HPA070789 antibody. Corresponding DBH RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to endoplasmic reticulum & vesicles.
  • Western blot analysis in human cell line SH-SY5Y.
Shipping:
Calculated at Checkout
$554.00
Adding to cart… The item has been added
Protein Description: dopamine beta-hydroxylase (dopamine beta-monooxygenase)
Gene Name: DBH
Alternative Gene Name: DBM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000889: 80%, ENSRNOG00000006641: 75%
Entrez Gene ID: 1621
Uniprot ID: P09172
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LINRFNNEDVCTCPQASVSQQFTSVPWNSFNRDVLKALYSFAPISMHCNKSSAVRFQGEWNLQPLPKVISTLEEPTPQCPTSQ
Gene Sequence LINRFNNEDVCTCPQASVSQQFTSVPWNSFNRDVLKALYSFAPISMHCNKSSAVRFQGEWNLQPLPKVISTLEEPTPQCPTSQ
Gene ID - Mouse ENSMUSG00000000889
Gene ID - Rat ENSRNOG00000006641
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DBH pAb (ATL-HPA070789 w/enhanced validation)
Datasheet Anti DBH pAb (ATL-HPA070789 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DBH pAb (ATL-HPA070789 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti DBH pAb (ATL-HPA070789 w/enhanced validation)
Datasheet Anti DBH pAb (ATL-HPA070789 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DBH pAb (ATL-HPA070789 w/enhanced validation)