Anti DAGLB pAb (ATL-HPA069377)

Atlas Antibodies

Catalog No.:
ATL-HPA069377-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: diacylglycerol lipase, beta
Gene Name: DAGLB
Alternative Gene Name: DAGLBETA, KCCR13L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039206: 78%, ENSRNOG00000001079: 80%
Entrez Gene ID: 221955
Uniprot ID: Q8NCG7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LVALDHRKESVVVAVRGTMSLQDVLTDLSAESEVLDVECEVQDRLAHKGISQAARYVYQRLINDGILSQAFSIA
Gene Sequence LVALDHRKESVVVAVRGTMSLQDVLTDLSAESEVLDVECEVQDRLAHKGISQAARYVYQRLINDGILSQAFSIA
Gene ID - Mouse ENSMUSG00000039206
Gene ID - Rat ENSRNOG00000001079
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DAGLB pAb (ATL-HPA069377)
Datasheet Anti DAGLB pAb (ATL-HPA069377) Datasheet (External Link)
Vendor Page Anti DAGLB pAb (ATL-HPA069377) at Atlas Antibodies

Documents & Links for Anti DAGLB pAb (ATL-HPA069377)
Datasheet Anti DAGLB pAb (ATL-HPA069377) Datasheet (External Link)
Vendor Page Anti DAGLB pAb (ATL-HPA069377)