Anti CYB5R3 pAb (ATL-HPA001566)

Atlas Antibodies

Catalog No.:
ATL-HPA001566-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: cytochrome b5 reductase 3
Gene Name: CYB5R3
Alternative Gene Name: DIA1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018042: 86%, ENSRNOG00000009592: 86%
Entrez Gene ID: 1727
Uniprot ID: P00387
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SGLLVYQGKGKFAIRPDKKSNPIIRTVKSVGMIAGGTGITPMLQVIRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNKHSARFKLWYTLDRAPEAWDYGQGFVNEEMIRDHLPPPEEEPLVLMCGPPPMIQYACLPNLDH
Gene Sequence SGLLVYQGKGKFAIRPDKKSNPIIRTVKSVGMIAGGTGITPMLQVIRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNKHSARFKLWYTLDRAPEAWDYGQGFVNEEMIRDHLPPPEEEPLVLMCGPPPMIQYACLPNLDH
Gene ID - Mouse ENSMUSG00000018042
Gene ID - Rat ENSRNOG00000009592
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CYB5R3 pAb (ATL-HPA001566)
Datasheet Anti CYB5R3 pAb (ATL-HPA001566) Datasheet (External Link)
Vendor Page Anti CYB5R3 pAb (ATL-HPA001566) at Atlas Antibodies

Documents & Links for Anti CYB5R3 pAb (ATL-HPA001566)
Datasheet Anti CYB5R3 pAb (ATL-HPA001566) Datasheet (External Link)
Vendor Page Anti CYB5R3 pAb (ATL-HPA001566)
Citations for Anti CYB5R3 pAb (ATL-HPA001566) – 3 Found
Jakobs, Heyka H; Mikula, Michal; Havemeyer, Antje; Strzalkowska, Adriana; Borowa-Chmielak, Monika; Dzwonek, Artur; Gajewska, Marta; Hennig, Ewa E; Ostrowski, Jerzy; Clement, Bernd. The N-reductive system composed of mitochondrial amidoxime reducing component (mARC), cytochrome b5 (CYB5B) and cytochrome b5 reductase (CYB5R) is regulated by fasting and high fat diet in mice. Plos One. 9(8):e105371.  PubMed
Lund, Rikke R; Leth-Larsen, Rikke; Caterino, Tina Di; Terp, Mikkel G; Nissen, Jeanette; Lænkholm, Anne-Vibeke; Jensen, Ole N; Ditzel, Henrik J. NADH-Cytochrome b5 Reductase 3 Promotes Colonization and Metastasis Formation and Is a Prognostic Marker of Disease-Free and Overall Survival in Estrogen Receptor-Negative Breast Cancer. Molecular & Cellular Proteomics : Mcp. 2015;14(11):2988-99.  PubMed
Rixen, Sophia; Havemeyer, Antje; Tyl-Bielicka, Anita; Pysniak, Kazimiera; Gajewska, Marta; Kulecka, Maria; Ostrowski, Jerzy; Mikula, Michal; Clement, Bernd. Mitochondrial amidoxime-reducing component 2 (MARC2) has a significant role in N-reductive activity and energy metabolism. The Journal Of Biological Chemistry. 2019;294(46):17593-17602.  PubMed