Anti CUTA pAb (ATL-HPA064369)

Atlas Antibodies

SKU: ATL-HPA064369-25

• 
• 

Protein Description: cutA divalent cation tolerance homolog (E. coli)
Gene Name: CUTA
Alternative Gene Name: ACHAP, C6orf82
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024194: 91%, ENSRNOG00000000481: 89%
Entrez Gene ID: 51596
Uniprot ID: O60888
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TSIYEWKGKIEEDSEVLMMIKTQSSLVPALTDFVRSVHPYEVAEVIALPVEQGNFPYLQWVRQVTESVSDSITVLP
• Gene Sequence: TSIYEWKGKIEEDSEVLMMIKTQSSLVPALTDFVRSVHPYEVAEVIALPVEQGNFPYLQWVRQVTESVSDSITVLP
• Gene ID - Mouse: ENSMUSG00000024194
• Gene ID - Rat: ENSRNOG00000000481
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.