Anti CUTA pAb (ATL-HPA064369)
Atlas Antibodies
- Catalog No.:
- ATL-HPA064369-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: CUTA
Alternative Gene Name: ACHAP, C6orf82
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024194: 91%, ENSRNOG00000000481: 89%
Entrez Gene ID: 51596
Uniprot ID: O60888
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TSIYEWKGKIEEDSEVLMMIKTQSSLVPALTDFVRSVHPYEVAEVIALPVEQGNFPYLQWVRQVTESVSDSITVLP |
| Gene Sequence | TSIYEWKGKIEEDSEVLMMIKTQSSLVPALTDFVRSVHPYEVAEVIALPVEQGNFPYLQWVRQVTESVSDSITVLP |
| Gene ID - Mouse | ENSMUSG00000024194 |
| Gene ID - Rat | ENSRNOG00000000481 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CUTA pAb (ATL-HPA064369) | |
| Datasheet | Anti CUTA pAb (ATL-HPA064369) Datasheet (External Link) |
| Vendor Page | Anti CUTA pAb (ATL-HPA064369) at Atlas Antibodies |
| Documents & Links for Anti CUTA pAb (ATL-HPA064369) | |
| Datasheet | Anti CUTA pAb (ATL-HPA064369) Datasheet (External Link) |
| Vendor Page | Anti CUTA pAb (ATL-HPA064369) |