Anti CTNNA1 pAb (ATL-HPA063535)
Atlas Antibodies
- Catalog No.:
- ATL-HPA063535-100
- Shipping:
- Calculated at Checkout
$593.00
Gene Name: CTNNA1
Alternative Gene Name: CAP102
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037815: 95%, ENSRNOG00000005796: 93%
Entrez Gene ID: 1495
Uniprot ID: P35221
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TASDDASQHQGGGGGELAYALNNFDKQIIVDPLSFSEERFRP |
| Gene Sequence | TASDDASQHQGGGGGELAYALNNFDKQIIVDPLSFSEERFRP |
| Gene ID - Mouse | ENSMUSG00000037815 |
| Gene ID - Rat | ENSRNOG00000005796 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CTNNA1 pAb (ATL-HPA063535) | |
| Datasheet | Anti CTNNA1 pAb (ATL-HPA063535) Datasheet (External Link) |
| Vendor Page | Anti CTNNA1 pAb (ATL-HPA063535) at Atlas Antibodies |
| Documents & Links for Anti CTNNA1 pAb (ATL-HPA063535) | |
| Datasheet | Anti CTNNA1 pAb (ATL-HPA063535) Datasheet (External Link) |
| Vendor Page | Anti CTNNA1 pAb (ATL-HPA063535) |