Anti CTB-133G6.1 pAb (ATL-HPA049151)

Atlas Antibodies

Catalog No.:
ATL-HPA049151-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description:
Gene Name: CTB-133G6.1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074497: 65%, ENSRNOG00000056981: 67%
Entrez Gene ID:
Uniprot ID: I3L1I5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LKTWTQGCLSGGGTPAESPGKECDSPKKRGRSRSVPVSFYEIRSPEISPGLEVPTPPVQGLEPPVLECMEKDHVEPDH
Gene Sequence LKTWTQGCLSGGGTPAESPGKECDSPKKRGRSRSVPVSFYEIRSPEISPGLEVPTPPVQGLEPPVLECMEKDHVEPDH
Gene ID - Mouse ENSMUSG00000074497
Gene ID - Rat ENSRNOG00000056981
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CTB-133G6.1 pAb (ATL-HPA049151)
Datasheet Anti CTB-133G6.1 pAb (ATL-HPA049151) Datasheet (External Link)
Vendor Page Anti CTB-133G6.1 pAb (ATL-HPA049151) at Atlas Antibodies

Documents & Links for Anti CTB-133G6.1 pAb (ATL-HPA049151)
Datasheet Anti CTB-133G6.1 pAb (ATL-HPA049151) Datasheet (External Link)
Vendor Page Anti CTB-133G6.1 pAb (ATL-HPA049151)