Anti CTB-133G6.1 pAb (ATL-HPA049151)
Atlas Antibodies
- Catalog No.:
- ATL-HPA049151-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: CTB-133G6.1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074497: 65%, ENSRNOG00000056981: 67%
Entrez Gene ID:
Uniprot ID: I3L1I5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LKTWTQGCLSGGGTPAESPGKECDSPKKRGRSRSVPVSFYEIRSPEISPGLEVPTPPVQGLEPPVLECMEKDHVEPDH |
| Gene Sequence | LKTWTQGCLSGGGTPAESPGKECDSPKKRGRSRSVPVSFYEIRSPEISPGLEVPTPPVQGLEPPVLECMEKDHVEPDH |
| Gene ID - Mouse | ENSMUSG00000074497 |
| Gene ID - Rat | ENSRNOG00000056981 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CTB-133G6.1 pAb (ATL-HPA049151) | |
| Datasheet | Anti CTB-133G6.1 pAb (ATL-HPA049151) Datasheet (External Link) |
| Vendor Page | Anti CTB-133G6.1 pAb (ATL-HPA049151) at Atlas Antibodies |
| Documents & Links for Anti CTB-133G6.1 pAb (ATL-HPA049151) | |
| Datasheet | Anti CTB-133G6.1 pAb (ATL-HPA049151) Datasheet (External Link) |
| Vendor Page | Anti CTB-133G6.1 pAb (ATL-HPA049151) |