Anti CT45A1 pAb (ATL-HPA044757)
Atlas Antibodies
- Catalog No.:
- ATL-HPA044757-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CT45A1
Alternative Gene Name: CT45-1, CT45.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000064016: 47%, ENSRNOG00000046662: 45%
Entrez Gene ID: 541466
Uniprot ID: Q5HYN5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QGPTAVRKRFFESIIKEAARCMRRDFVKHLKKKLKRMI |
Gene Sequence | QGPTAVRKRFFESIIKEAARCMRRDFVKHLKKKLKRMI |
Gene ID - Mouse | ENSMUSG00000064016 |
Gene ID - Rat | ENSRNOG00000046662 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CT45A1 pAb (ATL-HPA044757) | |
Datasheet | Anti CT45A1 pAb (ATL-HPA044757) Datasheet (External Link) |
Vendor Page | Anti CT45A1 pAb (ATL-HPA044757) at Atlas Antibodies |
Documents & Links for Anti CT45A1 pAb (ATL-HPA044757) | |
Datasheet | Anti CT45A1 pAb (ATL-HPA044757) Datasheet (External Link) |
Vendor Page | Anti CT45A1 pAb (ATL-HPA044757) |