Anti CSK pAb (ATL-HPA028425 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA028425-25

• 
• 
• 

Protein Description: c-src tyrosine kinase
Gene Name: CSK
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032312: 98%, ENSRNOG00000019374: 95%
Entrez Gene ID: 1445
Uniprot ID: P41240
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: WSFGILLWEIYSFGRVPYPRIPLKDVVPRVEKGYKMDAPDGCPPAVYEVMKNCWHLDAAMRPSFLQLREQLEHIKTHELH
• Gene Sequence: WSFGILLWEIYSFGRVPYPRIPLKDVVPRVEKGYKMDAPDGCPPAVYEVMKNCWHLDAAMRPSFLQLREQLEHIKTHELH
• Gene ID - Mouse: ENSMUSG00000032312
• Gene ID - Rat: ENSRNOG00000019374
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CSK pAb (ATL-HPA028425 w/enhanced validation) – 2 Found

Gallagher, S J; Rambow, F; Kumasaka, M; Champeval, D; Bellacosa, A; Delmas, V; Larue, L. Beta-catenin inhibits melanocyte migration but induces melanoma metastasis. Oncogene. 2013;32(17):2230-8. 

Zhou, Fuchun; Elzi, David J; Jayabal, Panneerselvam; Ma, Xiuye; Chiu, Yu-Chiao; Chen, Yidong; Blackman, Barron; Weintraub, Susan T; Houghton, Peter J; Shiio, Yuzuru. GDF6-CD99 Signaling Regulates Src and Ewing Sarcoma Growth. Cell Reports. 2020;33(5):108332.