Anti CRYZ pAb (ATL-HPA023290 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA023290-25

• 
• 

Protein Description: crystallin, zeta (quinone reductase)
Gene Name: CRYZ
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028199: 82%, ENSRNOG00000028319: 82%
Entrez Gene ID: 1429
Uniprot ID: Q08257
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KLMRAVRVFEFGGPEVLKLRSDIAVPIPKDHQVLIKVHACGVNPVETYIRSGTYSRKPLLPYTPGSDVAGVIEAVGDNASAFKKGDRVFTSSTISGGYAEYALAADHTVYKLPE
• Gene Sequence: KLMRAVRVFEFGGPEVLKLRSDIAVPIPKDHQVLIKVHACGVNPVETYIRSGTYSRKPLLPYTPGSDVAGVIEAVGDNASAFKKGDRVFTSSTISGGYAEYALAADHTVYKLPE
• Gene ID - Mouse: ENSMUSG00000028199
• Gene ID - Rat: ENSRNOG00000028319
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.