Anti CRYZ pAb (ATL-HPA023290 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA023290-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CRYZ
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028199: 82%, ENSRNOG00000028319: 82%
Entrez Gene ID: 1429
Uniprot ID: Q08257
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human, Mouse, Rat |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KLMRAVRVFEFGGPEVLKLRSDIAVPIPKDHQVLIKVHACGVNPVETYIRSGTYSRKPLLPYTPGSDVAGVIEAVGDNASAFKKGDRVFTSSTISGGYAEYALAADHTVYKLPE |
Gene Sequence | KLMRAVRVFEFGGPEVLKLRSDIAVPIPKDHQVLIKVHACGVNPVETYIRSGTYSRKPLLPYTPGSDVAGVIEAVGDNASAFKKGDRVFTSSTISGGYAEYALAADHTVYKLPE |
Gene ID - Mouse | ENSMUSG00000028199 |
Gene ID - Rat | ENSRNOG00000028319 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CRYZ pAb (ATL-HPA023290 w/enhanced validation) | |
Datasheet | Anti CRYZ pAb (ATL-HPA023290 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CRYZ pAb (ATL-HPA023290 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti CRYZ pAb (ATL-HPA023290 w/enhanced validation) | |
Datasheet | Anti CRYZ pAb (ATL-HPA023290 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CRYZ pAb (ATL-HPA023290 w/enhanced validation) |