Anti CRB3 pAb (ATL-HPA013835 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA013835-25

• 
• 

Protein Description: crumbs family member 3
Gene Name: CRB3
Alternative Gene Name: MGC17303
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044279: 91%, ENSRNOG00000047322: 91%
Entrez Gene ID: 92359
Uniprot ID: Q9BUF7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Gene Sequence: VRKLREKRQTEGTYRPSSEEQFSHAAEARAPQDSKETVQGCLPI
• Gene ID - Mouse: ENSMUSG00000044279
• Gene ID - Rat: ENSMUSG00000044279
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CRB3 pAb (ATL-HPA013835 w/enhanced validation) – 9 Found

Reginensi, Antoine; Hoshi, Masato; Boualia, Sami Kamel; Bouchard, Maxime; Jain, Sanjay; McNeill, Helen. Yap and Taz are required for Ret-dependent urinary tract morphogenesis. Development (Cambridge, England). 2015;142(15):2696-703. 

Reginensi, Antoine; Enderle, Leonie; Gregorieff, Alex; Johnson, Randy L; Wrana, Jeffrey L; McNeill, Helen. A critical role for NF2 and the Hippo pathway in branching morphogenesis. Nature Communications. 2016;7( 27480037):12309. 

McNeill, Helen; Reginensi, Antoine. Lats1/2 Regulate Yap/Taz to Control Nephron Progenitor Epithelialization and Inhibit Myofibroblast Formation. Journal Of The American Society Of Nephrology : Jasn. 2017;28(3):852-861. 

Li, P; Wang, Y; Mao, X; Jiang, Y; Liu, J; Li, J; Wang, J; Wang, R; She, J; Zhang, J; Yang, J; Liu, Y; Liu, P. CRB3 downregulation confers breast cancer stem cell traits through TAZ/β-catenin. Oncogenesis. 2017;6(4):e322. 

Zhu, Meng; Leung, Chuen Yan; Shahbazi, Marta N; Zernicka-Goetz, Magdalena. Actomyosin polarisation through PLC-PKC triggers symmetry breaking of the mouse embryo. Nature Communications. 2017;8(1):921. 

Freedman, Benjamin S; Brooks, Craig R; Lam, Albert Q; Fu, Hongxia; Morizane, Ryuji; Agrawal, Vishesh; Saad, Abdelaziz F; Li, Michelle K; Hughes, Michael R; Werff, Ryan Vander; Peters, Derek T; Lu, Junjie; Baccei, Anna; Siedlecki, Andrew M; Valerius, M Todd; Musunuru, Kiran; McNagny, Kelly M; Steinman, Theodore I; Zhou, Jing; Lerou, Paul H; Bonventre, Joseph V. Modelling kidney disease with CRISPR-mutant kidney organoids derived from human pluripotent epiblast spheroids. Nature Communications. 2015;6( 26493500):8715. 

Li, Pingping; Feng, Chen; Chen, He; Jiang, Yina; Cao, Fang; Liu, Jie; Liu, Peijun. Elevated CRB3 expression suppresses breast cancer stemness by inhibiting β-catenin signalling to restore tamoxifen sensitivity. Journal Of Cellular And Molecular Medicine. 2018;22(7):3423-3433. 

Li, Pingping; Zhou, Can; Yan, Yu; Li, Juan; Liu, Jie; Zhang, Yan; Liu, Peijun. Crumbs protein homolog 3 (CRB3) expression is associated with oestrogen and progesterone receptor positivity in breast cancer. Clinical And Experimental Pharmacology & Physiology. 2019;46(9):837-844. 

Dho, Sascha E; Silva-Gagliardi, Nancy; Morgese, Fabio; Coyaud, Etienne; Lamoureux, Emily; Berry, Donna M; Raught, Brian; McGlade, C Jane. Proximity interactions of the ubiquitin ligase Mind bomb 1 reveal a role in regulation of epithelial polarity complex proteins. Scientific Reports. 2019;9(1):12471.