Anti COX10 pAb (ATL-HPA032005 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA032005-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: COX10
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042148: 65%, ENSRNOG00000024972: 59%
Entrez Gene ID: 1352
Uniprot ID: Q12887
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PNEKELIELEPDSVIEDSIDVGKETKEEKRWKEMKLQVYDLPGILARLS |
| Gene Sequence | PNEKELIELEPDSVIEDSIDVGKETKEEKRWKEMKLQVYDLPGILARLS |
| Gene ID - Mouse | ENSMUSG00000042148 |
| Gene ID - Rat | ENSRNOG00000024972 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti COX10 pAb (ATL-HPA032005 w/enhanced validation) | |
| Datasheet | Anti COX10 pAb (ATL-HPA032005 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti COX10 pAb (ATL-HPA032005 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti COX10 pAb (ATL-HPA032005 w/enhanced validation) | |
| Datasheet | Anti COX10 pAb (ATL-HPA032005 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti COX10 pAb (ATL-HPA032005 w/enhanced validation) |
| Citations for Anti COX10 pAb (ATL-HPA032005 w/enhanced validation) – 2 Found |
| Bourens, Myriam; Barrientos, Antoni. A CMC1-knockout reveals translation-independent control of human mitochondrial complex IV biogenesis. Embo Reports. 2017;18(3):477-494. PubMed |
| Nývltová, Eva; Dietz, Jonathan V; Seravalli, Javier; Khalimonchuk, Oleh; Barrientos, Antoni. Coordination of metal center biogenesis in human cytochrome c oxidase. Nature Communications. 2022;13(1):3615. PubMed |