Anti COX10 pAb (ATL-HPA032005 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA032005-25

• 
• 

Protein Description: cytochrome c oxidase assembly homolog 10 (yeast)
Gene Name: COX10
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042148: 65%, ENSRNOG00000024972: 59%
Entrez Gene ID: 1352
Uniprot ID: Q12887
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PNEKELIELEPDSVIEDSIDVGKETKEEKRWKEMKLQVYDLPGILARLS
• Gene Sequence: PNEKELIELEPDSVIEDSIDVGKETKEEKRWKEMKLQVYDLPGILARLS
• Gene ID - Mouse: ENSMUSG00000042148
• Gene ID - Rat: ENSRNOG00000024972
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti COX10 pAb (ATL-HPA032005 w/enhanced validation) – 2 Found

Bourens, Myriam; Barrientos, Antoni. A CMC1-knockout reveals translation-independent control of human mitochondrial complex IV biogenesis. Embo Reports. 2017;18(3):477-494. 

Nývltová, Eva; Dietz, Jonathan V; Seravalli, Javier; Khalimonchuk, Oleh; Barrientos, Antoni. Coordination of metal center biogenesis in human cytochrome c oxidase. Nature Communications. 2022;13(1):3615.