Anti COL8A1 pAb (ATL-HPA053107 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA053107-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: COL8A1
Alternative Gene Name: C3orf7, MGC9568
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068196: 93%, ENSRNOG00000039668: 93%
Entrez Gene ID: 1295
Uniprot ID: P27658
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QGEYLPDMGLGIDGVKPPHAYGAKKGKNGGPAYEMPAFTAELTAPFPPVGAPVKFNKLLYNGRQNYNPQ |
Gene Sequence | QGEYLPDMGLGIDGVKPPHAYGAKKGKNGGPAYEMPAFTAELTAPFPPVGAPVKFNKLLYNGRQNYNPQ |
Gene ID - Mouse | ENSMUSG00000068196 |
Gene ID - Rat | ENSRNOG00000039668 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti COL8A1 pAb (ATL-HPA053107 w/enhanced validation) | |
Datasheet | Anti COL8A1 pAb (ATL-HPA053107 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti COL8A1 pAb (ATL-HPA053107 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti COL8A1 pAb (ATL-HPA053107 w/enhanced validation) | |
Datasheet | Anti COL8A1 pAb (ATL-HPA053107 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti COL8A1 pAb (ATL-HPA053107 w/enhanced validation) |
Citations for Anti COL8A1 pAb (ATL-HPA053107 w/enhanced validation) – 1 Found |
Corominas, Jordi; Colijn, Johanna M; Geerlings, Maartje J; Pauper, Marc; Bakker, Bjorn; Amin, Najaf; Lores Motta, Laura; Kersten, Eveline; Garanto, Alejandro; Verlouw, Joost A M; van Rooij, Jeroen G J; Kraaij, Robert; de Jong, Paulus T V M; Hofman, Albert; Vingerling, Johannes R; Schick, Tina; Fauser, Sascha; de Jong, Eiko K; van Duijn, Cornelia M; Hoyng, Carel B; Klaver, Caroline C W; den Hollander, Anneke I. Whole-Exome Sequencing in Age-Related Macular Degeneration Identifies Rare Variants in COL8A1, a Component of Bruch's Membrane. Ophthalmology. 2018;125(9):1433-1443. PubMed |