Anti CNTD2 pAb (ATL-HPA045615)

Atlas Antibodies

Catalog No.:
ATL-HPA045615-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: cyclin N-terminal domain containing 2
Gene Name: CNTD2
Alternative Gene Name: CCNP, FLJ13265
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002341: 29%, ENSRNOG00000010918: 33%
Entrez Gene ID: 79935
Uniprot ID: Q9H8S5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence SRLGPIVRRWAPRPSPLQSLAASLDAEPSSAAVPDGFPAGPTVSPRRLARPPGLEEALSALGLQGEREYAGDIFAEVM
Gene ID - Mouse ENSMUSG00000002341
Gene ID - Rat ENSMUSG00000002341
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CNTD2 pAb (ATL-HPA045615)
Datasheet Anti CNTD2 pAb (ATL-HPA045615) Datasheet (External Link)
Vendor Page Anti CNTD2 pAb (ATL-HPA045615) at Atlas Antibodies

Documents & Links for Anti CNTD2 pAb (ATL-HPA045615)
Datasheet Anti CNTD2 pAb (ATL-HPA045615) Datasheet (External Link)
Vendor Page Anti CNTD2 pAb (ATL-HPA045615)