Anti CMTR1 pAb (ATL-HPA029979 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA029979-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: CMTR1
Alternative Gene Name: FTSJD2, ISG95, KIAA0082, MTr1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000098374: 90%, ENSRNOG00000000532: 90%
Entrez Gene ID: 23070
Uniprot ID: Q8N1G2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SQGRKDIVEASSQKGRRGLGLTLRGFDQELNVDWRDEPEPSACEQVSWFPECTTEIPDTQEMSDWMVVGKRKMIIEDETEFCGEELLHSVLQCK |
| Gene Sequence | SQGRKDIVEASSQKGRRGLGLTLRGFDQELNVDWRDEPEPSACEQVSWFPECTTEIPDTQEMSDWMVVGKRKMIIEDETEFCGEELLHSVLQCK |
| Gene ID - Mouse | ENSMUSG00000098374 |
| Gene ID - Rat | ENSRNOG00000000532 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CMTR1 pAb (ATL-HPA029979 w/enhanced validation) | |
| Datasheet | Anti CMTR1 pAb (ATL-HPA029979 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CMTR1 pAb (ATL-HPA029979 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CMTR1 pAb (ATL-HPA029979 w/enhanced validation) | |
| Datasheet | Anti CMTR1 pAb (ATL-HPA029979 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CMTR1 pAb (ATL-HPA029979 w/enhanced validation) |
| Citations for Anti CMTR1 pAb (ATL-HPA029979 w/enhanced validation) – 2 Found |
| Daugherty, Matthew D; Schaller, Aaron M; Geballe, Adam P; Malik, Harmit S. Evolution-guided functional analyses reveal diverse antiviral specificities encoded by IFIT1 genes in mammals. Elife. 2016;5( 27240734) PubMed |
| Liang, Shang; Silva, Joana C; Suska, Olga; Lukoszek, Radoslaw; Almohammed, Rajaei; Cowling, Victoria H. CMTR1 is recruited to transcription start sites and promotes ribosomal protein and histone gene expression in embryonic stem cells. Nucleic Acids Research. 2022;50(5):2905-2922. PubMed |