Anti CMTR1 pAb (ATL-HPA029979 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA029979-25

• 
• 
• 

Protein Description: cap methyltransferase 1
Gene Name: CMTR1
Alternative Gene Name: FTSJD2, ISG95, KIAA0082, MTr1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000098374: 90%, ENSRNOG00000000532: 90%
Entrez Gene ID: 23070
Uniprot ID: Q8N1G2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SQGRKDIVEASSQKGRRGLGLTLRGFDQELNVDWRDEPEPSACEQVSWFPECTTEIPDTQEMSDWMVVGKRKMIIEDETEFCGEELLHSVLQCK
• Gene Sequence: SQGRKDIVEASSQKGRRGLGLTLRGFDQELNVDWRDEPEPSACEQVSWFPECTTEIPDTQEMSDWMVVGKRKMIIEDETEFCGEELLHSVLQCK
• Gene ID - Mouse: ENSMUSG00000098374
• Gene ID - Rat: ENSRNOG00000000532
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CMTR1 pAb (ATL-HPA029979 w/enhanced validation) – 2 Found

Daugherty, Matthew D; Schaller, Aaron M; Geballe, Adam P; Malik, Harmit S. Evolution-guided functional analyses reveal diverse antiviral specificities encoded by IFIT1 genes in mammals. Elife. 2016;5( 27240734) 

Liang, Shang; Silva, Joana C; Suska, Olga; Lukoszek, Radoslaw; Almohammed, Rajaei; Cowling, Victoria H. CMTR1 is recruited to transcription start sites and promotes ribosomal protein and histone gene expression in embryonic stem cells. Nucleic Acids Research. 2022;50(5):2905-2922.