Anti CLIC4 pAb (ATL-HPA008019 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA008019-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: chloride intracellular channel 4
Gene Name: CLIC4
Alternative Gene Name: CLIC4L, DKFZP566G223, H1, huH1, P64H1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037242: 98%, ENSRNOG00000018109: 97%
Entrez Gene ID: 25932
Uniprot ID: Q9Y696
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen THPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRKFLDGNEMTLADCNLLPKLHIVKVVAKKYRNFDIPKEMTGI
Gene Sequence THPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRKFLDGNEMTLADCNLLPKLHIVKVVAKKYRNFDIPKEMTGI
Gene ID - Mouse ENSMUSG00000037242
Gene ID - Rat ENSRNOG00000018109
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CLIC4 pAb (ATL-HPA008019 w/enhanced validation)
Datasheet Anti CLIC4 pAb (ATL-HPA008019 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CLIC4 pAb (ATL-HPA008019 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CLIC4 pAb (ATL-HPA008019 w/enhanced validation)
Datasheet Anti CLIC4 pAb (ATL-HPA008019 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CLIC4 pAb (ATL-HPA008019 w/enhanced validation)
Citations for Anti CLIC4 pAb (ATL-HPA008019 w/enhanced validation) – 3 Found
Lomnytska, M I; Becker, S; Gemoll, T; Lundgren, C; Habermann, J; Olsson, A; Bodin, I; Engström, U; Hellman, U; Hellman, K; Hellström, A-C; Andersson, S; Mints, M; Auer, G. Impact of genomic stability on protein expression in endometrioid endometrial cancer. British Journal Of Cancer. 2012;106(7):1297-305.  PubMed
Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.  PubMed
Yan, Haijing; Zhang, Xiangnan; Hu, Weiwei; Ma, Jing; Hou, Weiwei; Zhang, Xingzhou; Wang, Xiaofen; Gao, Jieqiong; Shen, Yao; Lv, Jianxin; Ohtsu, Hiroshi; Han, Feng; Wang, Guanghui; Chen, Zhong. Histamine H3 receptors aggravate cerebral ischaemic injury by histamine-independent mechanisms. Nature Communications. 2014;5( 24566390):3334.  PubMed