Anti CKS2 pAb (ATL-HPA030762)

Atlas Antibodies

SKU: ATL-HPA030762-25

• 

Protein Description: CDC28 protein kinase regulatory subunit 2
Gene Name: CKS2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062248: 99%, ENSRNOG00000014130: 99%
Entrez Gene ID: 1164
Uniprot ID: P33552
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRRPLPKDQQ
• Gene Sequence: HKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRRPLPKDQQ
• Gene ID - Mouse: ENSMUSG00000062248
• Gene ID - Rat: ENSRNOG00000014130
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CKS2 pAb (ATL-HPA030762) – 1 Found

Hollenstein, David Maria; Gérecová, Gabriela; Romanov, Natalie; Ferrari, Jessica; Veis, Jiri; Janschitz, Marion; Beyer, Reinhard; Schüller, Christoph; Ogris, Egon; Hartl, Markus; Ammerer, Gustav; Reiter, Wolfgang. A phosphatase-centric mechanism drives stress signaling response. Embo Reports. 2021;22(11):e52476.