Anti CKS2 pAb (ATL-HPA030762)
Atlas Antibodies
- Catalog No.:
- ATL-HPA030762-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CKS2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062248: 99%, ENSRNOG00000014130: 99%
Entrez Gene ID: 1164
Uniprot ID: P33552
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | HKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRRPLPKDQQ |
Gene Sequence | HKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRRPLPKDQQ |
Gene ID - Mouse | ENSMUSG00000062248 |
Gene ID - Rat | ENSRNOG00000014130 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CKS2 pAb (ATL-HPA030762) | |
Datasheet | Anti CKS2 pAb (ATL-HPA030762) Datasheet (External Link) |
Vendor Page | Anti CKS2 pAb (ATL-HPA030762) at Atlas Antibodies |
Documents & Links for Anti CKS2 pAb (ATL-HPA030762) | |
Datasheet | Anti CKS2 pAb (ATL-HPA030762) Datasheet (External Link) |
Vendor Page | Anti CKS2 pAb (ATL-HPA030762) |
Citations for Anti CKS2 pAb (ATL-HPA030762) – 1 Found |
Hollenstein, David Maria; Gérecová, Gabriela; Romanov, Natalie; Ferrari, Jessica; Veis, Jiri; Janschitz, Marion; Beyer, Reinhard; Schüller, Christoph; Ogris, Egon; Hartl, Markus; Ammerer, Gustav; Reiter, Wolfgang. A phosphatase-centric mechanism drives stress signaling response. Embo Reports. 2021;22(11):e52476. PubMed |