Anti CHN2 pAb (ATL-HPA018989)

Atlas Antibodies

SKU: ATL-HPA018989-25

• 

Protein Description: chimerin 2
Gene Name: CHN2
Alternative Gene Name: ARHGAP3, RhoGAP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004633: 100%, ENSRNOG00000009411: 100%
Entrez Gene ID: 1124
Uniprot ID: P52757
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ASSNSSLSGSSVSSDAEEYQPPIWKSYLYQLQQEAPRPKRIICPREVENRPKY
• Gene Sequence: ASSNSSLSGSSVSSDAEEYQPPIWKSYLYQLQQEAPRPKRIICPREVENRPKY
• Gene ID - Mouse: ENSMUSG00000004633
• Gene ID - Rat: ENSRNOG00000009411
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CHN2 pAb (ATL-HPA018989) – 3 Found

Elaimy, Ameer L; Guru, Santosh; Chang, Cheng; Ou, Jianhong; Amante, John J; Zhu, Lihua Julie; Goel, Hira Lal; Mercurio, Arthur M. VEGF-neuropilin-2 signaling promotes stem-like traits in breast cancer cells by TAZ-mediated repression of the Rac GAP β2-chimaerin. Science Signaling. 2018;11(528) 

Alvi, Muhammad A; McArt, Darragh G; Kelly, Paul; Fuchs, Marc-Aurel; Alderdice, Matthew; McCabe, Clare M; Bingham, Victoria; McGready, Claire; Tripathi, Shailesh; Emmert-Streib, Frank; Loughrey, Maurice B; McQuaid, Stephen; Maxwell, Perry; Hamilton, Peter W; Turkington, Richard; James, Jacqueline A; Wilson, Richard H; Salto-Tellez, Manuel. Comprehensive molecular pathology analysis of small bowel adenocarcinoma reveals novel targets with potential for clinical utility. Oncotarget. 2015;6(25):20863-74. 

Casado-Medrano, Victoria; Barrio-Real, Laura; García-Rostán, Ginesa; Baumann, Matti; Rocks, Oliver; Caloca, María J. A new role of the Rac-GAP β2-chimaerin in cell adhesion reveals opposite functions in breast cancer initiation and tumor progression. Oncotarget. 2016;7(19):28301-19.