Anti CHGB pAb (ATL-HPA008759 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA008759-25
  • Immunohistochemistry analysis in human adrenal gland and liver tissues using HPA008759 antibody. Corresponding CHGB RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line SH-SY5Y shows localization to vesicles.
  • Western blot analysis in human cell line SH-SY5Y.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: chromogranin B (secretogranin 1)
Gene Name: CHGB
Alternative Gene Name: SCG1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027350: 73%, ENSRNOG00000021269: 73%
Entrez Gene ID: 1114
Uniprot ID: P05060
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KQYSSHHTAEKRKRLGELFNPYYDPLQWKSSHFERRDNMNDNFLEGEEENELTLNEKNFFPEYNYDWWEKKPFSEDVNWGYEKRNLARVPKLDLKRQYDRVAQLDQLLHYRKKSAEFPDFYDS
Gene Sequence KQYSSHHTAEKRKRLGELFNPYYDPLQWKSSHFERRDNMNDNFLEGEEENELTLNEKNFFPEYNYDWWEKKPFSEDVNWGYEKRNLARVPKLDLKRQYDRVAQLDQLLHYRKKSAEFPDFYDS
Gene ID - Mouse ENSMUSG00000027350
Gene ID - Rat ENSRNOG00000021269
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CHGB pAb (ATL-HPA008759 w/enhanced validation)
Datasheet Anti CHGB pAb (ATL-HPA008759 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CHGB pAb (ATL-HPA008759 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CHGB pAb (ATL-HPA008759 w/enhanced validation)
Datasheet Anti CHGB pAb (ATL-HPA008759 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CHGB pAb (ATL-HPA008759 w/enhanced validation)



Citations for Anti CHGB pAb (ATL-HPA008759 w/enhanced validation) – 1 Found
Chen, Helen; Victor, A Kaitlyn; Klein, Jonathon; Tacer, Klementina Fon; Tai, Derek Jc; de Esch, Celine; Nuttle, Alexander; Temirov, Jamshid; Burnett, Lisa C; Rosenbaum, Michael; Zhang, Yiying; Ding, Li; Moresco, James J; Diedrich, Jolene K; Yates, John R 3rd; Tillman, Heather S; Leibel, Rudolph L; Talkowski, Michael E; Billadeau, Daniel D; Reiter, Lawrence T; Potts, Patrick Ryan. Loss of MAGEL2 in Prader-Willi syndrome leads to decreased secretory granule and neuropeptide production. Jci Insight. 2020;5(17)  PubMed