Anti CELF6 pAb (ATL-HPA046985)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046985-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CELF6
Alternative Gene Name: BRUNOL6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032297: 86%, ENSRNOG00000052224: 86%
Entrez Gene ID: 60677
Uniprot ID: Q96J87
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TLPGLPAPIGVNGFGPLTPQTNGQPGSDTLYNNGLS |
| Gene Sequence | TLPGLPAPIGVNGFGPLTPQTNGQPGSDTLYNNGLS |
| Gene ID - Mouse | ENSMUSG00000032297 |
| Gene ID - Rat | ENSRNOG00000052224 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CELF6 pAb (ATL-HPA046985) | |
| Datasheet | Anti CELF6 pAb (ATL-HPA046985) Datasheet (External Link) |
| Vendor Page | Anti CELF6 pAb (ATL-HPA046985) at Atlas Antibodies |
| Documents & Links for Anti CELF6 pAb (ATL-HPA046985) | |
| Datasheet | Anti CELF6 pAb (ATL-HPA046985) Datasheet (External Link) |
| Vendor Page | Anti CELF6 pAb (ATL-HPA046985) |