Anti CDR2 pAb (ATL-HPA018151 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA018151-25
  • Immunohistochemical staining of human testis shows strong cytoplasmic  and nuclear positivity in cells in seminiferous ducts.
  • Western blot analysis using Anti-CDR2 antibody HPA018151 (A) shows similar pattern to independent antibody HPA023870 (B).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: cerebellar degeneration-related protein 2, 62kDa
Gene Name: CDR2
Alternative Gene Name: CDR62, Yo
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030878: 88%, ENSRNOG00000017260: 88%
Entrez Gene ID: 1039
Uniprot ID: Q01850
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GVEKLVPDSLYVPFKEPSQSLLEEMFLTVPESHRKPLKRSSSETILSSLAGSDIVKGHEETCIRRAKAVKQRGISLLHEVDTQYSALKVKYEELLKKCQEEQDSLSHKAVQTSRAAAKDLTGV
Gene Sequence GVEKLVPDSLYVPFKEPSQSLLEEMFLTVPESHRKPLKRSSSETILSSLAGSDIVKGHEETCIRRAKAVKQRGISLLHEVDTQYSALKVKYEELLKKCQEEQDSLSHKAVQTSRAAAKDLTGV
Gene ID - Mouse ENSMUSG00000030878
Gene ID - Rat ENSRNOG00000017260
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CDR2 pAb (ATL-HPA018151 w/enhanced validation)
Datasheet Anti CDR2 pAb (ATL-HPA018151 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CDR2 pAb (ATL-HPA018151 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CDR2 pAb (ATL-HPA018151 w/enhanced validation)
Datasheet Anti CDR2 pAb (ATL-HPA018151 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CDR2 pAb (ATL-HPA018151 w/enhanced validation)



Citations for Anti CDR2 pAb (ATL-HPA018151 w/enhanced validation) – 2 Found
Eichler, Tilo W; Totland, Cecilie; Haugen, Mette; Qvale, Tor H; Mazengia, Kibret; Storstein, Anette; Haukanes, Bjørn I; Vedeler, Christian A. CDR2L Antibodies: A New Player in Paraneoplastic Cerebellar Degeneration. Plos One. 8(6):e66002.  PubMed
Herdlevaer, Ida; Kråkenes, Torbjørn; Schubert, Manja; Vedeler, Christian A. Localization of CDR2L and CDR2 in paraneoplastic cerebellar degeneration. Annals Of Clinical And Translational Neurology. 2020;7(11):2231-2242.  PubMed