Anti CDR2 pAb (ATL-HPA018151 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA018151-25

Protein Description: cerebellar degeneration-related protein 2, 62kDa
Gene Name: CDR2
Alternative Gene Name: CDR62, Yo
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030878: 88%, ENSRNOG00000017260: 88%
Entrez Gene ID: 1039
Uniprot ID: Q01850
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GVEKLVPDSLYVPFKEPSQSLLEEMFLTVPESHRKPLKRSSSETILSSLAGSDIVKGHEETCIRRAKAVKQRGISLLHEVDTQYSALKVKYEELLKKCQEEQDSLSHKAVQTSRAAAKDLTGV
• Gene Sequence: GVEKLVPDSLYVPFKEPSQSLLEEMFLTVPESHRKPLKRSSSETILSSLAGSDIVKGHEETCIRRAKAVKQRGISLLHEVDTQYSALKVKYEELLKKCQEEQDSLSHKAVQTSRAAAKDLTGV
• Gene ID - Mouse: ENSMUSG00000030878
• Gene ID - Rat: ENSRNOG00000017260
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CDR2 pAb (ATL-HPA018151 w/enhanced validation) – 2 Found

Eichler, Tilo W; Totland, Cecilie; Haugen, Mette; Qvale, Tor H; Mazengia, Kibret; Storstein, Anette; Haukanes, Bjørn I; Vedeler, Christian A. CDR2L Antibodies: A New Player in Paraneoplastic Cerebellar Degeneration. Plos One. 8(6):e66002. 

Herdlevaer, Ida; Kråkenes, Torbjørn; Schubert, Manja; Vedeler, Christian A. Localization of CDR2L and CDR2 in paraneoplastic cerebellar degeneration. Annals Of Clinical And Translational Neurology. 2020;7(11):2231-2242.