Anti CDC34 pAb (ATL-HPA002382)

Atlas Antibodies

Catalog No.:
ATL-HPA002382-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: cell division cycle 34
Gene Name: CDC34
Alternative Gene Name: E2-CDC34, UBC3, UBE2R1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020307: 98%, ENSRNOG00000060530: 98%
Entrez Gene ID: 997
Uniprot ID: P49427
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LNEPNTFSPANVDASVMYRKWKESKGKDREYTDIIRKQVLGTKVDAERDGVKVPTTLAEYCVKTKAPAPDEGSDLFYDDYYEDGEVEEEADSCFGDDEDDSGT
Gene Sequence LNEPNTFSPANVDASVMYRKWKESKGKDREYTDIIRKQVLGTKVDAERDGVKVPTTLAEYCVKTKAPAPDEGSDLFYDDYYEDGEVEEEADSCFGDDEDDSGT
Gene ID - Mouse ENSMUSG00000020307
Gene ID - Rat ENSRNOG00000060530
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CDC34 pAb (ATL-HPA002382)
Datasheet Anti CDC34 pAb (ATL-HPA002382) Datasheet (External Link)
Vendor Page Anti CDC34 pAb (ATL-HPA002382) at Atlas Antibodies

Documents & Links for Anti CDC34 pAb (ATL-HPA002382)
Datasheet Anti CDC34 pAb (ATL-HPA002382) Datasheet (External Link)
Vendor Page Anti CDC34 pAb (ATL-HPA002382)
Citations for Anti CDC34 pAb (ATL-HPA002382) – 1 Found
Takagi, Keiko; Takayama, Tadatoshi; Midorikawa, Yutaka; Hasegawa, Hiromasa; Ochiai, Takanaga; Moriguchi, Masamichi; Higaki, Tokio; Soma, Masayoshi; Nagase, Hiroki; Fujiwara, Kyoko. Cell division cycle 34 is highly expressed in hepatitis C virus-positive hepatocellular carcinoma with favorable phenotypes. Biomedical Reports. 2017;7(1):41-46.  PubMed