Anti CDC14A pAb (ATL-HPA023783)

Atlas Antibodies

Catalog No.: ATL-HPA023783-25

Protein Description: cell division cycle 14A
Gene Name: CDC14A
Alternative Gene Name: cdc14, Cdc14A1, Cdc14A2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033502: 81%, ENSRNOG00000014515: 82%
Entrez Gene ID: 8556
Uniprot ID: Q9UNH5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QQHFLEEKQASLWVQGDIFRSKLKNRPSSEGSINKILSGLDDMSIGGNLSKTQNMERFGEDNLEDDDVEMKNGITQGDKLRAL
• Gene Sequence: QQHFLEEKQASLWVQGDIFRSKLKNRPSSEGSINKILSGLDDMSIGGNLSKTQNMERFGEDNLEDDDVEMKNGITQGDKLRAL
• Gene ID - Mouse: ENSMUSG00000033502
• Gene ID - Rat: ENSRNOG00000014515
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.