Anti CD34 pAb (ATL-HPA036722 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA036722-25

Protein Description: CD34 molecule
Gene Name: CD34
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016494: 63%, ENSRNOG00000045558: 56%
Entrez Gene ID: 947
Uniprot ID: P28906
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAG
• Gene Sequence: ATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAG
• Gene ID - Mouse: ENSMUSG00000016494
• Gene ID - Rat: ENSRNOG00000045558
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CD34 pAb (ATL-HPA036722 w/enhanced validation) – 3 Found

Yang, Bao; Yang, Chenlong; Fang, Jingyi; Yang, Jun; Xu, Yulun. Clinicoradiological characteristics, management and prognosis of primary myeloid sarcoma of the central nervous system: A report of four cases. Oncology Letters. 2017;14(3):3825-3831. 

Hsieh, Mei Jen; Chiu, Tai-Jan; Lin, Yu Chun; Weng, Ching-Chieh; Weng, Yu-Ting; Hsiao, Chang-Chun; Cheng, Kuang-Hung. Inactivation of APC Induces CD34 Upregulation to Promote Epithelial-Mesenchymal Transition and Cancer Stem Cell Traits in Pancreatic Cancer. International Journal Of Molecular Sciences. 2020;21(12) 

Barad, Maya; Csukasi, Fabiana; Bosakova, Michaela; Martin, Jorge H; Zhang, Wenjuan; Paige Taylor, S; Lachman, Ralph S; Zieba, Jennifer; Bamshad, Michael; Nickerson, Deborah; Chong, Jessica X; Cohn, Daniel H; Krejci, Pavel; Krakow, Deborah; Duran, Ivan. Biallelic mutations in LAMA5 disrupts a skeletal noncanonical focal adhesion pathway and produces a distinct bent bone dysplasia. Ebiomedicine. 2020;62( 33242826):103075.