Anti CCNH pAb (ATL-HPA044138)
Atlas Antibodies
- Catalog No.:
- ATL-HPA044138-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: CCNH
Alternative Gene Name: CycH, p34, p37
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021548: 97%, ENSRNOG00000031656: 98%
Entrez Gene ID: 902
Uniprot ID: P51946
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, ChIP |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MYHNSSQKRHWTFSSEEQLARLRADANRKFRCKAVANGKVLPNDPVFLEPHEEMTLCKYYEKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFVGNLRESPLGQEKALEQILEYELL |
| Gene Sequence | MYHNSSQKRHWTFSSEEQLARLRADANRKFRCKAVANGKVLPNDPVFLEPHEEMTLCKYYEKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFVGNLRESPLGQEKALEQILEYELL |
| Gene ID - Mouse | ENSMUSG00000021548 |
| Gene ID - Rat | ENSRNOG00000031656 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CCNH pAb (ATL-HPA044138) | |
| Datasheet | Anti CCNH pAb (ATL-HPA044138) Datasheet (External Link) |
| Vendor Page | Anti CCNH pAb (ATL-HPA044138) at Atlas Antibodies |
| Documents & Links for Anti CCNH pAb (ATL-HPA044138) | |
| Datasheet | Anti CCNH pAb (ATL-HPA044138) Datasheet (External Link) |
| Vendor Page | Anti CCNH pAb (ATL-HPA044138) |