Anti CCNH pAb (ATL-HPA044138)

Atlas Antibodies

Catalog No.:
ATL-HPA044138-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: cyclin H
Gene Name: CCNH
Alternative Gene Name: CycH, p34, p37
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021548: 97%, ENSRNOG00000031656: 98%
Entrez Gene ID: 902
Uniprot ID: P51946
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MYHNSSQKRHWTFSSEEQLARLRADANRKFRCKAVANGKVLPNDPVFLEPHEEMTLCKYYEKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFVGNLRESPLGQEKALEQILEYELL
Gene Sequence MYHNSSQKRHWTFSSEEQLARLRADANRKFRCKAVANGKVLPNDPVFLEPHEEMTLCKYYEKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFVGNLRESPLGQEKALEQILEYELL
Gene ID - Mouse ENSMUSG00000021548
Gene ID - Rat ENSRNOG00000031656
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CCNH pAb (ATL-HPA044138)
Datasheet Anti CCNH pAb (ATL-HPA044138) Datasheet (External Link)
Vendor Page Anti CCNH pAb (ATL-HPA044138) at Atlas Antibodies

Documents & Links for Anti CCNH pAb (ATL-HPA044138)
Datasheet Anti CCNH pAb (ATL-HPA044138) Datasheet (External Link)
Vendor Page Anti CCNH pAb (ATL-HPA044138)