Anti CCNDBP1 pAb (ATL-HPA041065)

Atlas Antibodies

Catalog No.:
ATL-HPA041065-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: cyclin D-type binding-protein 1
Gene Name: CCNDBP1
Alternative Gene Name: DIP1, GCIP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023572: 81%, ENSRNOG00000011379: 76%
Entrez Gene ID: 23582
Uniprot ID: O95273
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SPENNDLISYNSVWVACQQMPQIPRDNKAAALLMLTKNVDFVKDAHEEMEQAVEECDPYSGLLNDTEENNSDNHNHEDDVLGFPSNQD
Gene Sequence SPENNDLISYNSVWVACQQMPQIPRDNKAAALLMLTKNVDFVKDAHEEMEQAVEECDPYSGLLNDTEENNSDNHNHEDDVLGFPSNQD
Gene ID - Mouse ENSMUSG00000023572
Gene ID - Rat ENSRNOG00000011379
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CCNDBP1 pAb (ATL-HPA041065)
Datasheet Anti CCNDBP1 pAb (ATL-HPA041065) Datasheet (External Link)
Vendor Page Anti CCNDBP1 pAb (ATL-HPA041065) at Atlas Antibodies

Documents & Links for Anti CCNDBP1 pAb (ATL-HPA041065)
Datasheet Anti CCNDBP1 pAb (ATL-HPA041065) Datasheet (External Link)
Vendor Page Anti CCNDBP1 pAb (ATL-HPA041065)