Anti CCNDBP1 pAb (ATL-HPA041065)

Atlas Antibodies

SKU: ATL-HPA041065-25

• 
• 

Protein Description: cyclin D-type binding-protein 1
Gene Name: CCNDBP1
Alternative Gene Name: DIP1, GCIP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023572: 81%, ENSRNOG00000011379: 76%
Entrez Gene ID: 23582
Uniprot ID: O95273
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SPENNDLISYNSVWVACQQMPQIPRDNKAAALLMLTKNVDFVKDAHEEMEQAVEECDPYSGLLNDTEENNSDNHNHEDDVLGFPSNQD
• Gene Sequence: SPENNDLISYNSVWVACQQMPQIPRDNKAAALLMLTKNVDFVKDAHEEMEQAVEECDPYSGLLNDTEENNSDNHNHEDDVLGFPSNQD
• Gene ID - Mouse: ENSMUSG00000023572
• Gene ID - Rat: ENSRNOG00000011379
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.