Anti CBFA2T2 pAb (ATL-HPA060523 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA060523-100

• 
• 

Protein Description: core-binding factor, runt domain, alpha subunit 2; translocated to, 2
Gene Name: CBFA2T2
Alternative Gene Name: MTGR1, ZMYND3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038533: 57%, ENSRNOG00000016352: 55%
Entrez Gene ID: 9139
Uniprot ID: O43439
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MAKESGISLKEIQVLARQWKVGPEKRVPAMPGSPVEVKIQSRSSPPTMPPL
• Gene Sequence: MAKESGISLKEIQVLARQWKVGPEKRVPAMPGSPVEVKIQSRSSPPTMPPL
• Gene ID - Mouse: ENSMUSG00000038533
• Gene ID - Rat: ENSRNOG00000016352
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.