Anti CAPN13 pAb (ATL-HPA030034)

Atlas Antibodies

Catalog No.:
ATL-HPA030034-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: calpain 13
Gene Name: CAPN13
Alternative Gene Name: FLJ23523
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043705: 79%, ENSRNOG00000032375: 78%
Entrez Gene ID: 92291
Uniprot ID: Q6MZZ7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ISRELLHLVTLRYSDSVGRVSFPSLVCFLMRLEAMAKTFRNLSKDGKGLYLTEMEWMSLVMYN
Gene Sequence ISRELLHLVTLRYSDSVGRVSFPSLVCFLMRLEAMAKTFRNLSKDGKGLYLTEMEWMSLVMYN
Gene ID - Mouse ENSMUSG00000043705
Gene ID - Rat ENSRNOG00000032375
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CAPN13 pAb (ATL-HPA030034)
Datasheet Anti CAPN13 pAb (ATL-HPA030034) Datasheet (External Link)
Vendor Page Anti CAPN13 pAb (ATL-HPA030034) at Atlas Antibodies

Documents & Links for Anti CAPN13 pAb (ATL-HPA030034)
Datasheet Anti CAPN13 pAb (ATL-HPA030034) Datasheet (External Link)
Vendor Page Anti CAPN13 pAb (ATL-HPA030034)