Anti CAPN13 pAb (ATL-HPA030034)
Atlas Antibodies
- Catalog No.:
- ATL-HPA030034-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CAPN13
Alternative Gene Name: FLJ23523
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043705: 79%, ENSRNOG00000032375: 78%
Entrez Gene ID: 92291
Uniprot ID: Q6MZZ7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ISRELLHLVTLRYSDSVGRVSFPSLVCFLMRLEAMAKTFRNLSKDGKGLYLTEMEWMSLVMYN |
Gene Sequence | ISRELLHLVTLRYSDSVGRVSFPSLVCFLMRLEAMAKTFRNLSKDGKGLYLTEMEWMSLVMYN |
Gene ID - Mouse | ENSMUSG00000043705 |
Gene ID - Rat | ENSRNOG00000032375 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CAPN13 pAb (ATL-HPA030034) | |
Datasheet | Anti CAPN13 pAb (ATL-HPA030034) Datasheet (External Link) |
Vendor Page | Anti CAPN13 pAb (ATL-HPA030034) at Atlas Antibodies |
Documents & Links for Anti CAPN13 pAb (ATL-HPA030034) | |
Datasheet | Anti CAPN13 pAb (ATL-HPA030034) Datasheet (External Link) |
Vendor Page | Anti CAPN13 pAb (ATL-HPA030034) |