Anti CALHM1 pAb (ATL-HPA018317)

Atlas Antibodies

SKU:
ATL-HPA018317-25
  • Immunohistochemical staining of human cerebral cortex shows cytoplasmic positivity in neurons.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: calcium homeostasis modulator 1
Gene Name: CALHM1
Alternative Gene Name: FAM26C
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079258: 82%, ENSRNOG00000030682: 80%
Entrez Gene ID: 255022
Uniprot ID: Q8IU99
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CTEHAKAFAKVCIQQFFEAMNHDLELGHTHGTLATAPASAAAPTTPDGAEEEREKLRGITDQGTMNRLLTSWHKCKPPLRLGQEEPPLMGNGW
Gene Sequence CTEHAKAFAKVCIQQFFEAMNHDLELGHTHGTLATAPASAAAPTTPDGAEEEREKLRGITDQGTMNRLLTSWHKCKPPLRLGQEEPPLMGNGW
Gene ID - Mouse ENSMUSG00000079258
Gene ID - Rat ENSRNOG00000030682
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CALHM1 pAb (ATL-HPA018317)
Datasheet Anti CALHM1 pAb (ATL-HPA018317) Datasheet (External Link)
Vendor Page Anti CALHM1 pAb (ATL-HPA018317) at Atlas Antibodies

Documents & Links for Anti CALHM1 pAb (ATL-HPA018317)
Datasheet Anti CALHM1 pAb (ATL-HPA018317) Datasheet (External Link)
Vendor Page Anti CALHM1 pAb (ATL-HPA018317)



Citations for Anti CALHM1 pAb (ATL-HPA018317) – 2 Found
Taruno, Akiyuki. ATP Release Channels. International Journal Of Molecular Sciences. 2018;19(3)  PubMed
Kashio, Makiko; Wei-Qi, Gao; Ohsaki, Yasuyoshi; Kido, Mizuho A; Taruno, Akiyuki. CALHM1/CALHM3 channel is intrinsically sorted to the basolateral membrane of epithelial cells including taste cells. Scientific Reports. 2019;9(1):2681.  PubMed