Anti CALHM1 pAb (ATL-HPA018317)

Atlas Antibodies

Catalog No.: ATL-HPA018317-25

Protein Description: calcium homeostasis modulator 1
Gene Name: CALHM1
Alternative Gene Name: FAM26C
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079258: 82%, ENSRNOG00000030682: 80%
Entrez Gene ID: 255022
Uniprot ID: Q8IU99
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CTEHAKAFAKVCIQQFFEAMNHDLELGHTHGTLATAPASAAAPTTPDGAEEEREKLRGITDQGTMNRLLTSWHKCKPPLRLGQEEPPLMGNGW
• Gene Sequence: CTEHAKAFAKVCIQQFFEAMNHDLELGHTHGTLATAPASAAAPTTPDGAEEEREKLRGITDQGTMNRLLTSWHKCKPPLRLGQEEPPLMGNGW
• Gene ID - Mouse: ENSMUSG00000079258
• Gene ID - Rat: ENSRNOG00000030682
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CALHM1 pAb (ATL-HPA018317) – 2 Found

Taruno, Akiyuki. ATP Release Channels. International Journal Of Molecular Sciences. 2018;19(3) 

Kashio, Makiko; Wei-Qi, Gao; Ohsaki, Yasuyoshi; Kido, Mizuho A; Taruno, Akiyuki. CALHM1/CALHM3 channel is intrinsically sorted to the basolateral membrane of epithelial cells including taste cells. Scientific Reports. 2019;9(1):2681.