Anti CALHM1 pAb (ATL-HPA018317)
Atlas Antibodies
- Catalog No.:
- ATL-HPA018317-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: CALHM1
Alternative Gene Name: FAM26C
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079258: 82%, ENSRNOG00000030682: 80%
Entrez Gene ID: 255022
Uniprot ID: Q8IU99
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | CTEHAKAFAKVCIQQFFEAMNHDLELGHTHGTLATAPASAAAPTTPDGAEEEREKLRGITDQGTMNRLLTSWHKCKPPLRLGQEEPPLMGNGW |
| Gene Sequence | CTEHAKAFAKVCIQQFFEAMNHDLELGHTHGTLATAPASAAAPTTPDGAEEEREKLRGITDQGTMNRLLTSWHKCKPPLRLGQEEPPLMGNGW |
| Gene ID - Mouse | ENSMUSG00000079258 |
| Gene ID - Rat | ENSRNOG00000030682 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CALHM1 pAb (ATL-HPA018317) | |
| Datasheet | Anti CALHM1 pAb (ATL-HPA018317) Datasheet (External Link) |
| Vendor Page | Anti CALHM1 pAb (ATL-HPA018317) at Atlas Antibodies |
| Documents & Links for Anti CALHM1 pAb (ATL-HPA018317) | |
| Datasheet | Anti CALHM1 pAb (ATL-HPA018317) Datasheet (External Link) |
| Vendor Page | Anti CALHM1 pAb (ATL-HPA018317) |
| Citations for Anti CALHM1 pAb (ATL-HPA018317) – 2 Found |
| Taruno, Akiyuki. ATP Release Channels. International Journal Of Molecular Sciences. 2018;19(3) PubMed |
| Kashio, Makiko; Wei-Qi, Gao; Ohsaki, Yasuyoshi; Kido, Mizuho A; Taruno, Akiyuki. CALHM1/CALHM3 channel is intrinsically sorted to the basolateral membrane of epithelial cells including taste cells. Scientific Reports. 2019;9(1):2681. PubMed |